(S)-2-Amino-3-methoxypropanoic+acid
Catalog Number:
(10247-144)
Supplier:
Bioss
Description:
Amisyn is a mostly cytosolic protein related to Tomosyn which plays an important role in SNARE complex assembly. Amisyn contains a v-SNARE coiled coil homology domain that binds to Syntaxin 1A and weakly to Syntaxin 4. Three isoforms exist for Amisyn. Isoform 1 is the full length protein, isoform 2 has a different amino acid sequence between residues 204-210 and isoform 3 is missing amino acids 1-102 and contains a different sequence for amino acids 103-150. Amisyn lacks a transmembrane domain and therefore is unable to assemble into a functional, membrane-anchored SNARE complex. This suggests that Amisyn may instead be acting to maintain SNARE conformation and facilitate the binding of VAMP-2. Amisyn can inhibit exocytosis independent of Syntaxin binding.
Supplier:
PeproTech, Inc.
Description:
CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NNT-1/BSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Murine Cardiotrophin-1 is a 21.3 kDa protein consisting of 202 amino acid residues.
Catalog Number:
(103008-022)
Supplier:
Anaspec Inc
Description:
This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR MW:1600.8 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10288-382)
Supplier:
Bioss
Description:
Cytochrome P450 proteins are heme-thiolate monooxygenases that mediate NADPH-dependent electron transport and function to oxidize a variety of structurally unrelated compounds, including steroids, fatty acids and xenobiotics. Specifically, Cytochrome P450s are responsible for metabolizing arachidonic acid to hydroxyeicosatetraenoic acid (a regulator of blood pressure) and epoxyeicosatrienoic acid (a molecule involved in signaling events). CYP20A1 (cytochrome P450, family 20, subfamily A, polypeptide 1), also known as CYP-M, is a 462 amino acid single-pass membrane protein that belongs to the cytochrome P450 family. CYP20A1 is thought to carry its own oxygen as it lacks a conserved I-helix motif and one amino acid of its conserved heme binding site.
Catalog Number:
(76303-716)
Supplier:
PeproTech, Inc.
Description:
Myostatin is a TGF-beta family member that acts as an inhibitor of skeletal muscle growth. This muscle-specific cytokine interacts with Activin type I and type II receptors, and suppresses myoblast proliferation by arresting cell-cycle in the G1 phase. Suppression of myostatin activity facilitates muscle formation, and may be useful in reducing and/or preventing adiposity and type-2 diabetes. Myostatin activity can be blocked by the activin-binding protein follistatin, and by the propeptide of myostatin. Recombinant Human/Murine/Rat Myostatin is a 25.0 kDa protein consisting of two identical 109 amino acid polypeptides linked by a single disulfide bond. The amino acid sequence of mature myostatin is extremely conserved across species, and is the same in murine, rat, chicken, turkey, porcine, and human. Myostatin is expressed as the C-terminal part of a precursor polypeptide, which also contains a short N-terminal signal sequence for secretion, and a propeptide of 243 amino acids. After dimerization of this precursor, the covalent bonds between the propeptide and the mature ligand are cleaved by furin-type proteases. However, the resulting two proteins remain associated through non-covalent interactions, and are secreted as a latent complex.
Supplier:
Bachem Americas
Description:
Sequence: H-Homoarg-OH
Supplier:
ALADDIN SCIENTIFIC
Description:
Heterobifunctional PEG derivative that can be used to modify proteins, peptides and other materials via amino or other acid reactive chemical groups. PEGylation can increase solubility and stability and reduce immunogenicity of peptides and proteins. It can also suppress the non-specific binding of charged molecules to the modified surfaces.
Catalog Number:
(103662-852)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human DPYS (NP_001376.1) (Met1-Pro519) was fused with two additional amino acids (Gly and Pro) at the N-terminus.
Supplier:
PeproTech, Inc.
Description:
Programmed cell death protein 1 (PD-1), or CD279, is a type I inhibitory transmembrane receptor of the CD28 receptor family that, along with its B7 family ligands, programmed death ligand 1 (PD-L1) and programmed death ligand 2 (PD-L2), belongs to the immunoglobulin superfamily. While other CD28 family members are expressed predominantly in T cells, PD-1 is widely expressed and found in multiple lymphocytes including T cells, B cells, myeloid, and NKT cells upon activation. PD-1 is a negative regulator of immune response, and is referred to as an inhibitory immune checkpoint molecule. Ligation with PD-L1 or PD-L2 results in inhibited activation, proliferation, and cytokine secretion (e.g. IFN-gamma, IL-10) in T cells, ultimately dampening immune response. Despite the strong homology between PD-L1 and PD-L2, each ligand appears to display distinct lymphokine expression patterns and potency. Blockage of PD-1 ligation by monoclonal antibodies has been proven to be an effective anti-tumor treatment by allowing the immune response to remain active and attack the tumorigenic cells that otherwise would have escaped detection. PD-1 and its ligands have been implicated in numerous autoimmune diseases, inflammatory liver disease and cancers. The naturally occurring human PD-1 monomer consists of a 150 amino acid extracellular domain, a 21 amino acid transmembrane domain, and a 97 amino acid cytoplasmic domain. PeproTech's CHO cell-derived Recombinant Human PD-1 Fc is a glycosylated, disulfide-linked homodimer of 501 amino acid residues whose monomer consists of the 268-amino-acid length mature PD-1 sequence fused to the 231-amino-acid length Fc portion of human IgG1 by two glycines. The calculated molecular weight of monomeric CHO cell-derived Recombinant Human PD-1 Fc is 55.3 kDa, however, due to glycosylation, it migrates at an apparent molecular weight of approximately 180-200 kDa by SDS-PAGE analysis under non-reducing conditions.
Supplier:
Bachem Americas
Description:
Sequence: H-4-Cyano-Phe-OH
Catalog Number:
(103665-350)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acids (Met 1-Thr 245) of mouse OMGP (Q63912) was expressed, with a C-terminal polyhistidine tag.
Catalog Number:
(PAV9411)
Supplier:
Promega Corporation
Description:
Recombinant human InsR (amino acids 1011-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. InsR is the insulin receptor tyrosine kinase that is involved in insulin signaling.
Catalog Number:
(103508-398)
Supplier:
Acros Organics
Description:
Adenosine 5'-monophosphate, Cas number: 61-19-8, Purity: 99%, Molecular Weight: 347.22, Molecular Formula: C10 H14 N5 O7 P, Form: Solid, Color: Red brown, Synonyms: 5'-Adenylic acid, 5'-AMP, Size: 100G
Supplier:
MP Biomedicals
Description:
amino acid found in human plasma and thyroid gland, similar to thyroxine
Catalog Number:
(103009-742)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ MW:3248.51 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(76101-914)
Supplier:
Bioss
Description:
RAP2B belongs to a family of RAS-related GTP-binding proteins. RAP proteins share approximately 50% amino acid identity with the classical RAS proteins and have numerous structural features in common. However, at their 61st amino acid the glutamine in RAS proteins is replaced by threonine in RAP proteins. RAP2A interacts with phospholipase C, epsilon 1 (PLCE1).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||