Text Search >
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Print…
You Searched For:
163,563 results were found
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Supplier:
Tosoh Bioscience
Description:
Recommended for small molecular weight compounds (<10000 Da) such as peptides, amino acids, tryptic digests, nucleotides, pharmaceutical molecules, and food and beverage samples.
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
L(-)-Glutathione (oxidised form) 98%
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13 residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV Molecular Weight: 4233.8 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Supplier:
PeproTech, Inc.
Description:
Growth and differentiation factor-associated serum protein-1 (GASP-1) is a secreted inhibitory TGF-β binding protein that contains multiple protease inhibitor structural domains. It is expressed primarily in the ovary, testis, and brain, and can act as a potent soluble inhibitor of myostatin and GDF-11, but not Activin A. The GASP-1 gene encodes a 571 amino acid protein that contains a 29 amino acid secretion signal sequence, and multiple identifiable structural features, including a WAP domain, a follistatin/Kazal domain, an immunoglobulin domain, two tandem Kunitz domains, and a netrin domain. Recombinant Human GASP-1 is a 542 amino acid protein that migrates at an apparent molecular weight of approximately 55-66 kDa by SDS-PAGE analysis under non-reducing conditions. The calculated molecular weight of Recombinant Human GASP-1 is 59.9 kDa.
Supplier:
BeanTown Chemical
Description:
CAS: 3844-45-9; EC No: 223-339-8; MDL No: MFCD00001657; RTECS: BQ4725000
Powder; Molecular Formula: C37H34Na2N2O9S3; MW: 792.85
Melting Point: 283° (decomposes)
Supplier:
Prosci
Description:
TNF-alpha is a pleiotrophic pro-inflammatory cytokine secreted by various cells including adipocytes, activated monocytes, macrophages, B cells, T cells and fibroblasts. It belongs to the TNF family of ligands and signals through two receptors, TNFR1 and TNFR2. TNF-alpha is cytotoxic to a wide variety of tumor cells and is an essential factor in mediating the immune response against bacterial infections. TNF-alpha also plays a role in the induction of septic shock, auto immune diseases, rheumatoid arthritis, inflammation, and diabetes. Recombinant murine TNF-alpha is a soluble 156 amino acid protein (17.3 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein. Recombinant human TNF-a is a soluble 157 amino acid protein (17.4 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein. Recombinant rat TNFTNF-a is a soluble 157 amino acid protein (17.3 kDa) which corresponds to C-terminal extracellular domain of the full length transmembrane protein.
Supplier:
PeproTech, Inc.
Description:
IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.
Catalog Number:
(103887-330)
Supplier:
Sino Biological
Description:
NUP210 Protein, Recombinant (GST Tag), Purity: > 95 % as determined by SDS-PAGE, Expressed Host: Baculovirus-Insect Cells, Species: Human, Molecular mass: consists of 279 amino acids, MW: 31.7 kDa, Protein construction: expressed with a GST tag at the N-terminus, Size: 100uG
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042089-250MG , MDL Number: MFCD02682583
Supplier:
ALADDIN SCIENTIFIC
Description:
It is a 3-substituted isoxazole derivative. It is a structural isomer of 5-aminoisoxazole.It may be used in the following studies: . As a reagent in the synthesis of N-(4-(N-isoxazol-3-ylsulfamoyl)phenyl)acetamide. . As a starting material in the synthesis of N-(isoxazol-3-yl)-N’-(carbomethoxy)thiourea. . As a starting material in the synthesis of (Z)-2-(5-amino-1,2,4-thiadiazol-3-yl)-2-methoxy-iminoacetic acid, a side-chain of the fourth generation of cephem antibiotics.
Supplier:
AMBEED, INC
Description:
Boc-L-Nle(6-OH) 95%
Catalog Number:
(75789-626)
Supplier:
Prosci
Description:
Multiple Inositol Polyphosphate Phosphatase 1/MINPP1 is an enzyme that removes 3-phosphate from inositol phosphate substrates. MINPP1 also converts 2,3 bisphosphoglycerate (2,3-BPG) to 2-phosphoglycerate. MINPP1 is synthesized as a 487 amino acid precursor that contains an 30 amino acid signal peptide and a 457 amino aicd mature chain. MINPP1 is widely expressed with the highest levels found in kidney, liver and placenta. It acts as a phosphoinositide 5- and phosphoinositide 6-phosphatase and regulates cellular levels of inositol pentakisphosphate (InsP5) and inositol hexakisphosphate (InsP6). MINPP1 may play a role in bone development (endochondral ossification).
Supplier:
AAT BIOQUEST INC
Description:
Calcium measurement is critical for numerous biological investigations.
Supplier:
AMBEED, INC
Description:
N(α)-Cbz-L-tryptophan 97%
Catalog Number:
(PAV5581)
Supplier:
Promega Corporation
Description:
Factor Xa Protease preferentially cleaves after the arginine residue in the amino acid sequence Ile-Glu-Gly-Arg.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
