Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid


163,915  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163915"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (B-4040.0001BA)

Supplier:  Bachem Americas
Description:   Please see also the corresponding amino acid derivatives Fmoc-(Dmb)Ala-OH (B-4175), Fmoc-(Dmb)Gly-OH (B-4170), Fmoc-(Hmb)Gly-OH (B-3490), and Fmoc-(Dmb)Leu-OH (B-4165).
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human CD33 (AAH28152.1) (Met1-His259) was expressed with five amino acids (DDDDK) at the C-terminus.
Supplier:  MP Biomedicals
Description:   Bovine albumin is a single polypeptide chain consisting of approximately 583 to 595 amino acid residues and no carbohydrates. At pH 5-7 it contains 17 intrachain disulfide bridges and 1 sulfhydryl group.
Supplier:  TCI America
Description:   CAS Number: 6994-25-8
MDL Number: MFCD00005238
Molecular Formula: C6H9N3O2
Molecular Weight: 155.16
Purity/Analysis Method: >98.0% (GC,T)
Form: Crystal
Melting point (°C): 102
MSDS SDS

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of mouse and rat beta-amyloid differing from human beta-amyloid by three amino acid residues: Gly5, Phe10, and Arg13. This peptide is biotinylated at the C-terminus.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVV-K(Biotin)-NH2
Molecular Weight: 4587.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   3-Aminopyrazine-2-carboxamide, 96%
MSDS SDS
Supplier:  Tosoh Bioscience
Description:   Recommended for small molecular weight compounds (<10000 Da) such as peptides, amino acids, tryptic digests, nucleotides, pharmaceutical molecules, and food and beverage samples.
Supplier:  AMBEED, INC
Description:   CGS 21680 98%
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-D-Glu(OtBu)-OH · H₂O CAS-No.: 104091-08-9 Mol.weight: 443.50 SumFormula: C₂₄H₂₇NO₆ · H₂O Bulk item no.: B-1320 Synonym(s): EINECS no.: - MDL no.: MFCD00797526
Supplier:  Bachem Americas
Description:   Diphenyldiazomethane was used industrially for producing benzhydryl esters (diphenylmethyl esters) of β-lactam antibiotics. This "polymeric diphenyldiazomethane" readily reacts with carboxylic acids, e.g. Fmoc-amino acids, which need not to be activated. Products can be cleaved from this very acid-sensitive resin derivative with 1-5 % TFA in dichloromethane.
Supplier:  LGC STANDARDS
Description:   2-Amino-3-hydroxy-2-(hydroxymethyl)propyl Phosphate Barium Salt, TRC, LGC Standards
New Product
Catalog Number: (10100-920)

Supplier:  Prosci
Description:   ACADL belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in ACADL gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.The protein encoded by this gene belongs to the acyl-CoA dehydrogenase family, which is a family of mitochondrial flavoenzymes involved in fatty acid and branched chain amino-acid metabolism. This protein is one of the four enzymes that catalyze the initial step of mitochondrial beta-oxidation of straight-chain fatty acid. Defects in this gene are the cause of long-chain acyl-CoA dehydrogenase (LCAD) deficiency, leading to nonketotic hypoglycemia.

Supplier:  MilliporeSigma
MSDS SDS
Catalog Number: (77978-877)

Supplier:  LGC STANDARDS
Description:   Boric Acid, TRC, LGC Standards
New Product
Catalog Number: (100295-270)

Supplier:  Indofine Chemical Company
Description:   Rare Organics & BioChemicals 3262-72-4 25gm BOC-Ser-OH 205.2 Room temperature.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Matrix Scientific
Description:   MF=C10H10N2O2 MW=190.20 CAS=57213-48-6 MDL=MFCD01860885 10G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,057 - 7,072  of 163,915