Text Search >
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Print…
You Searched For:
164,279 results were found
(S)-2-Amino-6-(3-carboxypropanamido)hexanoic+acid
Supplier:
Bachem Americas
Description:
Sequence: H-Val-OtBu · HCl
Supplier:
AMBEED, INC
Description:
DL-Histidine 95%
Catalog Number:
(75789-838)
Supplier:
Prosci
Description:
Mouse CCL24 is a secreted protein, which is a member of the CC chemokine subfamily. Mouse Ccl24 cDNA encodes a 119 amino acid residue precursor protein, shares approximately 58% amino acid sequence identity with human Ccl24. It is predominantly expressed in the jejunum and spleen and also be induced in the lung by allergen challengeand IL4. Mouse ccl24 has lower chemotactic activity for neutrophils but none for monocytes and activated lymphocytes. Ccl24 is chemotactic for resting T-lymphocytes, eosinophils and can bind to CCR3. LPS and IL4 also differentially regulate the expression of Ccl24 in monocytes and macrophages.
Supplier:
PeproTech, Inc.
Description:
SCGF-α and -β are hematopoietic growth factors that exert their activity at early stages of hematopoiesis. The SCGFs are non-glycosylated species-specific cytokines that can support growth of primitive hematopoietic cells, and, in combination with EPO or GM-CSF, promote proliferation of erythroid or myeloid progenitors, respectively. Recombinant Human SCGF-β is a 25.0 kDa polypeptide containing 227 amino acid residues.
Catalog Number:
(10112-604)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: FADS1 antibody was raised against a 15 amino acid synthetic peptide near the internal region of FADS1, Application: ELISA, WB
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041257-100G , MDL Number: MFCD00037225
Supplier:
PeproTech, Inc.
Description:
Slit2 is a member of the Slit family that signals through the Roundabout (Robo) receptor as a repellent for axon guidance and neuronal migration, and also acts as a chemoattractant to vascular endothelial cells and a chemotaxis inhibitor for leukocytes. Slit2 is expressed primarily in the fetal lung, kidney, and adult spinal cord, and to a lesser extent in the adult adrenal gland, thyroid and trachea. Slit2 is initially synthesized as a 1499 amino acid precursor, which is subsequently cleaved into N-terminal and C-terminal fragments, designated as Slit2-N and Slit2-C respectively. The neurodevelopment-related activities, as measured by the ability to repel olfactory bulb axons and to induce branching in dorsal root ganglia axons, are contained only in the N-terminal fragment. Recombinant Human Slit2-N is a 1093 amino acid glycoprotein corresponding to the N-terminal portion of the full length Slit2 precursor, and has a calculated, theoretical molecular weight of 122.35 kDa. Due to glycosylation Slit2-N migrates at an apparent molecular weight of approximately 120.0-140.0 kDa by SDS-PAGE analysis under reducing conditions.
Catalog Number:
(10112-190)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Immunogen: GADD45 gamma antibody was raised against an 11 amino acid synthetic peptide near the internal region of GADD45 gamma, Application: ELISA
Catalog Number:
(10112-800)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Mouse, Immunogen: ORP7 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of ORP7, Application: ELISA
Catalog Number:
(10431-146)
Supplier:
Bioss
Description:
Catalyzes the specific attachment of an amino acid to its cognate tRNA in a 2 step reaction: the amino acid (AA) is first activated by ATP to form AA-AMP and then transferred to the acceptor end of the tRNA. When secreted, acts as a signaling molecule that induces immune response through the activation of monocyte/macrophages. Catalyzes the synthesis of diadenosine oligophosphate (Ap4A), a signaling molecule involved in the activation of MITF transcriptional activity. Interacts with HIV-1 virus GAG protein, facilitating the selective packaging of tRNA(3)(Lys), the primer for reverse transcription initiation.
Catalog Number:
(10671-736)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(10671-756)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(103634-408)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the amino acid sequence (Pro 285-Glu 413) of human NTRK1 (NP_002520.2), corresponding to the Ig-like C2-type 2 domain, was expressed and purified, with a N-terminal polyhistidine tag.
Catalog Number:
(10109-194)
Supplier:
Prosci
Description:
SLC7A4 is involved in the transport of the cationic amino acids (arginine, lysine and ornithine).
Supplier:
AMBEED, INC
Description:
L(+)-Glutamine 98%
Supplier:
Anaspec Inc
Description:
This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) MW:3464.1 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
