Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

2-(4-(1-Oxoisoindolin-2-yl)phenyl)butanoic acid


33,994  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"33994"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The Integrin alpha V beta 3 Antibody (23C6) [DyLight 350] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha V beta 3. This antibody reacts with human. The Integrin alpha V beta 3 Antibody (23C6) [DyLight 350] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.
Catalog Number: (103007-600)

Supplier:  Anaspec Inc
Description:   Several mutations in the beta amyloid precursor gene cause autosomal dominant Alzheimer's Disease in a number of kindreds. Among them, the Tottori mutation produces beta amyloid peptides with the D7N substitution at the peptide N terminus. This was reported to accelerate the kinetics of oligomers formation which act as fibril seeds and are more toxic to cultured neuronal cells.
Sequence: DAEFRHNSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Supplier:  Bioss
Description:   Microtubule-associated proteins (MAPs) regulate microtubule stability and play critical roles in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. MAP-light chain 3 beta (MAP-LC3 Beta) and MAP-light chain 3 alpha (MAP-LC3 alpha) are subunits of both MAP1A and MAP1B. MAP-LC3M Beta, a homolog of Apg8p, is essential for autophagy and associated to the autophagosome membranes after processing. Two forms of LC3 Beta, the cytosolic LC3-I and the membrane-bound LC3-II, are produced post-translationally. LC3-I is formed by the removal of the C-terminal 22 amino acids from newly synthesized LC3∫, followed by the conversion of a fraction of LC3-I into LC3-II. LC3 enhances fibronectin mRNA translation in ductus arteriosus cells through association with 60S ribosomes and binding to an AU-rich element in the 3’ untranslated region of fibronectin mRNA. This facilitates sorting of fibronectin mRNA onto rough endoplasmic reticulum and translation. MAP LC3 Beta may also be involved in formation of autophagosomal vacuoles. It is expressed primarily in heart, testis, brain and skeletal muscle.
Catalog Number: (76174-370)

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for Phosphatidylinositol 3-kinase regulatory subunit beta(PIK3R2) detection. Tested with WB in Human.

Supplier:  R&D Systems
Description:   The Recombinant Human CCL23/Ck beta 8-1 (aa 46-137) Protein from R&D Systems is derived from E. coli. The Recombinant Human CCL23/Ck beta 8-1 (aa 46-137) Protein has been validated for the following applications: Bioactivity.

Supplier:  Prosci
Description:   RELM-beta is a 19kDa disulfide-linked homodimeric protein expressed in the epithelium of the colon and small bowel. RELM-beta has been suggested to play a regulatory role during inflammation and may also act to establish links among adipose tissue, the intestine and the liver. Interestingly, the molecular structure of RELM-beta is highly homologous to that of the adipose-derived cytokine resistin.

Supplier:  Bioss
Description:   Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.

Supplier:  Boster Biological Technology
Description:   Rabbit IgG polyclonal antibody for TGF-beta receptor type-2(TGFBR2) detection. Tested with WB in Human;Mouse;Rat.

Supplier:  Novus Biologicals
Description:   The beta-Catenin Antibody (9C1) from Novus Biologicals is a mouse monoclonal antibody to beta-Catenin. This antibody reacts with human, mouse, rat, canine, monkey. The beta-Catenin Antibody (9C1) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunofluorescence.
Catalog Number: (76708-060)

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Inhibin beta-B(Inhbb) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Monkey Beta-Microseminoprotein(MSMB) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Beta-glucuronidase,betaGD ELISA Kit
Catalog Number: (76715-234)

Supplier:  AFG BIOSCIENCE LLC
Description:   Mouse Beta Actin(ACTB) ELISA Kit
Supplier:  R&D Systems
Description:   The Recombinant Rhesus Macaque IL-1 beta/IL-1F2 Protein from R&D Systems is derived from E. coli. The Recombinant Rhesus Macaque IL-1 beta/IL-1F2 Protein has been validated for the following applications: Bioactivity.

Supplier:  TCI America
Description:   CAS Number: 20880-92-6 MDL Number: MFCD00022183 Molecular Formula: C12H20O6 Molecular Weight: 260.29 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Melting point (°C): 96 Specific rotation [a]20/D: -34 deg (C=1, H2O) Storage Temperature: <lt/>0°C
MSDS SDS
Catalog Number: (89292-070)

Supplier:  Genetex
Description:   Rabbit polyclonal antibody to beta 2 Adaptin
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,217 - 1,232  of 33,994