Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

3-Methyl-4-(methylamino)phenol


29,090  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"29090"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  KEYSTONE ADJUSTABLE CAP CO., INC.
Description:   One-Step heavy duty SMS 2-ply wrappers provide an excellent microbial barrier. Ideal for pharmaceutical production applications.
Supplier:  TCI America
Description:   CAS Number: 52488-36-5
MDL Number: MFCD00671502
Molecular Formula: C8H6BrN
Molecular Weight: 196.05
Purity/Analysis Method: >97.0% (GC)
Form: Clear Liquid
Boiling point (°C): 96
Flash Point (°C): 110
Specific Gravity (20/20): 1.58
MSDS SDS
Supplier:  AMBEED, INC
Description:   (11bS)-N,N-Dipropyldinaphtho[2,1-d:1',2'-f][1,3,2]dioxaphosphepin-4-amine, Purity: 97%, CAS Number: 802902-36-9, Appearance: White to off-white powder or crystals, Storage: Inert atmosphere, 2-8C, Size: 100MG

Supplier:  AMBEED, INC
Description:   4-(Chloromethyl)-3-methylpyridine hydrochloride, Purity: 90%, CAS Number: 117934-36-8, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  Anaspec Inc
Description:   This GLP-1 (7-36)amide contains an additional Lysine (K) residue at its N-terminus, with Biotin coupled to the Lysine side chain. GLP-1 (7-36) amide is an incretin hormone that causes glucose dependent release of insulin by pancreatic beta cells. It is the cleavage product of GLP-1 (1-36) amide peptide (Cat# AS-22460). Both GLP-1 (7-36) and GLP-1 (7-37) - Cat# AS-20761, also play roles in gastric motility (gastric emptying), on the suppression of plasma glucagon levels (glucose production) and possibly on the promotion of satiety and stimulation of glucose disposal in peripheral tissues independent of the actions of insulin. GLP-1 (7-36) has a short half life of less than 2 minutes, and like GIP, is rapidly degraded by the enzyme dipeptidyl peptidase IV (DPP-4), which is widely expressed in a number of sites, including the endothelial cells of small gut arterioles. DPP-4 degrades GLP-1 (7-36) into the non insulinotropic GLP-1 (9-36) - Cat# AS-65070 (some studies suggest it may have weak insulinotropic activity). As a result, the majority of GLP-1 (and GIP) is inactivated as an insulinotrope before reaching the systemic circulation.
Sequence: HAEGTFTSDVSSYLEGQAAKEFIAWLVKGRK(Biotin)-NH2
MW: 3551.8 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Novus Biologicals
Description:   The AK3 Antibody (SJB3-36) from Novus Biologicals is a mouse monoclonal antibody to AK3. This antibody reacts with human. The AK3 Antibody (SJB3-36) has been validated for the following applications: Western Blot, ELISA, Immunohistochemistry, Immunohistochemistry-Paraffin, Immunohistochemistry-Frozen.
Supplier:  AMBEED, INC
Description:   8-Hydroxy-1-(salicylideneamino)naphthalene-3,6-disulfonic acid monosodium Salt, Purity: 98%, CAS Number: 5941-07-1, Appearance: Light yellow to Brown powder to crystal, Storage: Sealed in dry, Room Temperature, Size: 25g
Supplier:  AMBEED, INC
Description:   4,4',4''-Nitrilotribenzonitrile, Purity: 97%, CAS Number: 51545-36-9, Appearance: Solid, Storage: Sealed in dry, Room Temperature, Size: 100MG
Catalog Number: (TCT1500-005ML)

Supplier:  TCI America
Description:   CAS Number: 5272-36-6
MDL Number: MFCD00002913
Molecular Formula: C6H12OSi
Molecular Weight: 128.25
Purity/Analysis Method: >94.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 80
Flash Point (°C): 67
Specific Gravity (20/20): 0.90
MSDS SDS
Supplier:  Novus Biologicals
Description:   Keratin 36 Lysate (Adult Normal)
Catalog Number: (TCT1523-001ML)

Supplier:  TCI America
Description:   CAS Number: 79265-36-4
MDL Number: MFCD00191506
Molecular Formula: C6H11NSSi
Molecular Weight: 157.31
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Color: Colorless
Boiling point (°C): 65
Specific Gravity (20/20): 1.00
MSDS SDS
Catalog Number: (TCD0174-025G)

Supplier:  TCI America
Description:   CAS Number: 533-98-2
MDL Number: MFCD00000157
Molecular Formula: C4H8Br2
Molecular Weight: 215.92
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 166
Specific Gravity (20/20): 1.80
MSDS SDS
Catalog Number: (700011-072)

Supplier:  Spectrum Chemicals
Description:   Polyoxyethylene (10) Tridecyl Ether is a water soluble, nonionic surfactant and is an effective wetting agent or degreaser in a number of home care applications.
Small Business Enterprise
Supplier:  BeanTown Chemical
Description:   CAS: 624-28-2; EC No: 210-839-6; MDL No: MFCD00006221 Powder; Molecular Formula: C5H3Br2N ; MW: 236.89 Melting Point: 92-95°
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C9H10O2 MW=150.18 Cas=644-36-0 MDL=MFCD00004328 25G
Supplier:  AMBEED, INC
Description:   Boc-Pyr-Obzl, Purity: 97%, CAS Number: 113400-36-5, Appearance: White to Yellow Solid, Storage: Sealed in dry, 2-8C, Size: 100G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,009 - 5,024  of 29,090