Easy access to products and protocols for research use only in the identification of 2019-nCoV based on Centers for Disease Control and Prevention (CDC) recommendations
Our solutions, developed with you as our focus, are crafted by our team and network of professionals with advanced degrees in science, quality control, engineering, manufacturing and industry experience.
A strong, vibrant research and development group is the lifeblood of all industries. VWR will support you from the latest life science products to the guaranteed purity of organic building blocks...
VWR is ready to support your production facility with reliable access to raw materials and essential supplies. We can also help you increase productivity...
This carefully selected portfolio is specifically designed to help you prevent potential contamination and maintain aseptic conditions in cleanrooms and controlled environments...
VWR is proud of our years of experience providing choice and excellent service to the Industrial market from Food & Beverage, Petrochemical, Environmental Testing, Waste Water, Cosmetics, Consumer Goods, Agriculture and more...
VWR is your complete source for workplace supplies. Binders, calendars, pens, cleaning and sanitation supplies, and office equipment are just some of the essential products we offer...
Avantor Services provides a wide range of specialized services and digital solutions to help you solve complex challenges.
We’ve built our reputation on consistent, comprehensive mastery of day-to-day operations, allowing lab, clinical, and production environments to focus their high-value resources on core scientific priorities.
As our customers’ needs have evolved, so have our capabilities. We have become experts in scientific operations, improving performance with sophisticated solutions and providing guidance on best practices.
You can select and customize services for peak efficiency, quality, and accelerated innovation.
Description:
A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom. Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) MW:3996 Da % peak area by HPLC:95 Storage condition:-20° C
Description:
Clear liquid. For low level trace metal analysis. Double-distilled and packaged in ISO Class 4 (FED-STD-209E Class 10/M2.5) cleanroom conditions. Supplied in specially designed, preleached fluoropolymer resin bottles to guarantee product integrity. Certificate of Analysis supplied.
Description:
(S)-2-Amino-3-(1H-imidazol-4-yl)propanoic acid hydrochloride, Purity: 97%, CAS Number: 645-35-2, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 25G
Description:
These high precision liquid-in-glass mercury thermometers are hand blown, which bear graduations, numbers and letters etched into the glass and filled with and inert gas above the mercury column
Description:
Imapexâ„¢ Peroxide Grade silicone tubing is designed for non-critical fluid transfer, peristaltic pump use, and general engineering applications.