Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,2'-Dithiodi(benzoic+acid)


154,193  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"154193"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (BT135170-10G)

Supplier:  BeanTown Chemical
Description:   CAS: 5445-22-7; EC No: 226-644-4 Liquid; Linear Formula: CH3(CH2)5CH(Br)COOCH3; Molecular Formula: C9H17BrO2; MW: 237.13 Boiling Point: 228°; Flash point: 102°C (216°F) Density (g/mL): 1.221
MSDS SDS
Catalog Number: (103530-916)

Supplier:  Acros Organics
Description:   1,3-Propane sultone, Purity: 97%, CAS Number: 1120-71-4, Molecular Formula: C3H6O3S, Molecular weight: 122.14, Synonyms: 1,2-Oxathiolane 2,2-dioxide, 3-Hydroxy-1-propanesulfonic acid gamma-sultone, Appearance: White to light yellow, Low melting solid or liquid, Size: 25G
Supplier:  Thermo Scientific Chemicals
Description:   50g CAS: 1572-98-1, MDL: MFCD00034667
MSDS SDS
Catalog Number: (77195-898)

Supplier:  AMBEED, INC
Description:   p-Toluic hydrazide, Purity: 98%, CAS Number: 3619-22-5, Appearance: Form: powder Colour: off-white to yellow, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 250mg
Supplier:  Thermo Scientific Chemicals
Description:   Reagent for determination of amino acids and amine containing compounds, as an intermediate.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   250mg CAS: 317802-08-7
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 196207-58-6, MDL: MFCD16294554
MSDS SDS
Supplier:  TCI America
Description:   [Spectrophotometric reagent for Al and other metals]
CAS Number: 1571-36-4
MDL Number: MFCD00045752
Molecular Formula: C26H26N6O10S2
Molecular Weight: 646.65
Form: Crystal
Color: Deep Yellow Red
MSDS SDS
Supplier:  APOLLO SCIENTIFIC
Description:   Isonicotinic acid 99%
Supplier:  AMBEED, INC
Description:   Tri-tert-butyl-1,4,7,10-tetraazacyclododecane-1,4,7-triacetate 98%
Supplier:  MP Biomedicals
Description:   PIPES is frequently used as a buffering agent in biochemistry; it is an ethanesulfonic acid buffer developed by Good et al. in the 1960s. PIPES has a pKa near the physiological pH which makes it useful in cell culture work.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00003541 Beilstein Registry No.: 1716295 Common Applications: Metal chelator Fieser: 1,373
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   6-Aminopenicillanic acid 95%
New Product
Supplier:  Thermo Scientific Chemicals
Description:   Powder, 22 mesh. Purity based on metal contaminates only.
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 13404-22-3
MDL Number: MFCD00035524
Molecular Formula: C7H15NO2
Molecular Weight: 181.66
Purity/Analysis Method: >97.0% (N)
Form: Crystal
Melting point (°C): 208
Specific rotation [a]20/D: 2 deg (C=2, EtOH)
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
3,889 - 3,904  of 154,193