Text Search >
2,2'-Dithiodi(benzoic+acid)
Print…
You Searched For:
154,193 results were found
2,2'-Dithiodi(benzoic+acid)
Catalog Number:
(RL100-4169)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Esterase (Porcine Liver) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Rabbit IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(103007-114)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA MW: 4442.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(RL100-101-211)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Glycerol Kinase (Celullomonas species) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL200-103-210S)
Supplier:
Rockland Immunochemical
Description:
Anti-Glycerol-3-Phosphate Dehydrogenase has been assayed against 1.0 µg of Glycerol-3-Phosphate-Dehydrogenase (Rabbit Muscle) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(10670-236)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF185 (ring finger protein 185), also known as FLJ38628, is a 192 amino acid multi-pass membrane protein containing one RING-type zinc finger. Two RNF185 isoforms exist as a result of alternative splicing, and the gene encoding RNF185 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(RL710-1602)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(EM8.22145.0250)
Catalog Number:
(76110-320)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(76110-318)
Supplier:
Bioss
Description:
The RING-type zinc finger motif is present in a number of viral and eukaryotic proteins and is made of a conserved cysteine-rich domain that is able to bind two zinc atoms. Proteins that contain this conserved domain are generally involved in the ubiquitination pathway of protein degradation. RNF215 (ring finger protein 215), is a 377 amino acid multi-pass membrane protein containing one RING-type zinc finger. The gene encoding RNF215 maps to human chromosome 22, which houses over 500 genes and is the second smallest human chromosome. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, Neurofibromatosis type 2, autism and schizophrenia.
Catalog Number:
(RL100-101-235)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Pyranose Oxidase (E.coli) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL100-101-231)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Sucrose Phosphorylase (E.coli) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL100-4142)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Arginase (Bovine Liver) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Rabbit IgG (H&L) (Goat) and (ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(10326-932)
Supplier:
Bioss
Description:
Motilin is a 22 amino acid peptide hormone expressed throughout the gastrointestinal (GI) tract. The protein encoded by this gene is a motilin receptor which is a member of the G-protein coupled receptor 1 family. This member is a multi-pass transmembrane protein, and is an important therapeutic target for the treatment of hypomotility disorders.
Catalog Number:
(RL100-101-148)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Folate Binding Protein (Bovine Milk) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(EM1.04593.0025)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
