Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,2\\\'-[ethylenebis(oxy)]bisacetic+acid


144,160  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"144160"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (101836-074)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 033639-500MG , MDL Number: MFCD05844466
Supplier:  AMBEED, INC
Description:   Ethyl 2-Cyano-2-methylpropionate, Purity: 98%, CAS Number: 1572-98-1, Appearance: Liquid, Storage: Sealed in dry, Room Temperature, Size: 500g

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 040715-500MG , MDL Number: MFCD06010034
Supplier:  TCI America
Description:   CAS Number: 141-04-8
MDL Number: MFCD00053722
Molecular Formula: C14H26O4
Molecular Weight: 258.36
Purity/Analysis Method: >99.0% (GC)
Form: Clear Liquid
Boiling point (°C): 293
Flash Point (°C): 156
Freezing point (°C): -22
Specific Gravity (20/20): 0.95
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Glyoxylic acid monohydrate 98%, pure

Supplier:  Bioss
Description:   CESK1, also known as CCT8L2 (chaperonin containing TCP1, subunit 8 theta-like 2), is a 557 amino acid protein that localizes to the cytoplasm and is thought to function as a molecular chaperone, possibly assisting protein folding after ATP hydrolysis. CESK1 belongs to the TCP-1 chaperonin family and is encoded by a gene which maps to human chromosome 22. Mutations in several of the genes that map to chromosome 22 are involved in the development of Phelan-McDermid syndrome, neurofibromatosis type 2, autism and schizophrenia. Additionally, translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia chromosome and the subsequent production of the novel fusion protein Bcr-Abl, a potent cell proliferation activator found in several types of leukemias.
Supplier:  AMBEED, INC
Description:   5-Methyl-1H-pyrazole-3-carboxylic acid 97%

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 033080-500MG , MDL Number: MFCD03420242

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 023941-500MG , MDL Number: MFCD05666757
Supplier:  TCI America
Description:   2,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9,9-dihexylfluorene, Purity: >98.0%(HPLC), Cas: 254755-24-3, MF: C37H56B2O4, MW: 586.47, Synonyms: 9,9-Dihexylfluorene-2,7-diboronic Acid Bis(pinacol) Ester, Size: 1G
MSDS SDS
Supplier:  Bioss
Description:   ODF3B, also known as ODF3L3 (outer dense fiber protein 3-like protein 3), is a 253 amino acid protein belonging to the ODF3 family. Existing as two isoforms produced by alternative splicing, ODF3B contains one DUF1309 repeat. The gene that encodes ODF3B maps to human chromosome 22, which contains over 500 genes and about 49 million bases. Being the second smallest human chromosome, 22 contains a surprising variety of interesting genes. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Supplier:  ALADDIN SCIENTIFIC
Description:   Product Application:2-Aminopyrimidine-5-boronic acid is used as pharmaceutical intermediates.
New Product
Supplier:  Spectrum Chemicals
Description:   TYROSINE, USP is one of 22 acids that are used by cells in order to synthesize proteins. It is a non essential amino acid that has a polar side group. It is an important part of photosynthesis as it acts as an electron donor in the reduction of oxidized chlorophyll. Spectrum Chemical USP products are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Supplier:  AMBEED, INC
Description:   1,3,5-Tris(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)benzene, Purity: 97%, CAS Number: 365564-05-2, Appearance: Form: Crystal - Powder / Colour: White - Slightly pale yellow, Storage: Inert atmosphere, Room Temperature, Size: 5G
Catalog Number: (103007-114)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Biolegend
Description:   Purified anti-human IL-22 [Poly5161]; Isotype: Goat Polyclonal Ig; Reactivity: Human; Apps: ELISA Capture; Size: 100 μg
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,305 - 2,320  of 144,160