Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,2-Difluoro-4-pentenoic+acid


156,421  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"156421"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   Powder, 22 mesh. Purity based on metal contaminates only.
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  ALADDIN SCIENTIFIC
Description:   Product Describtion:Reagent for the assay of singlett oxygen; it has better characteristics than 9,10-anthracenediyl-bis-dipropionic acid; In addition to the emission maximum at 407 nm, there are lower maxima at 431, 457 and 485 nmA useful O2 determining agent.Product Application:9,10-Anthracenediyl-bis(methylene)dimalonic acid is widely used as a singlet oxygen detector probe. 9,10-Anthracenediyl-bis(methylene)dimalonic acid is suitable for assessing the photodynamic effect of curcumin Vibrio parahaemolyticus, which is a significant cause of bacterial diarrhea
New Product
Supplier:  BeanTown Chemical
Description:   CAS: 125572-95-4; EC No: 236-308-9; MDL No: MFCD00149243 Crystalline/Powder; Molecular Formula: C14H22N2O8·H2O ; MW: 364.35 Melting Point: 213-216°
MSDS SDS
Catalog Number: (77157-014)

Supplier:  AMBEED, INC
Description:   (9R,9'S)-4,4'-Dihydroxy-10,10'-dioxo-5,5'-bis(((2S,3R,4S,5S,6R)-3,4,5-trihydroxy-6-(hydroxymethyl)tetrahydro-2H-pyran-2-yl)oxy)-9,9',10,10'-tetrahydro-[9,9'-bianthracene]-2,2'-dicarboxylic acid, Purity: 95%, CAS Number: 128-57-4, Appearance: Light-yellow to yellow powder or crystals, Size: 1mg
Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.  
Supplier:  Bachem Americas
Description:   Sequence: H-Trp-OH
Supplier:  AMBEED, INC
Description:   2,7-Bis(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)-9,9-di-n-octylfluorene 97%
Supplier:  AMBEED, INC
Description:   2-Isopropoxy-1,3-thiazole-5-boronic acid, pinacol ester ≥97%
New Product
Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10RB chains. IL-22 is a potent mediator of cellular inflammatory responses and wound healing.  
Supplier:  APOLLO SCIENTIFIC
Description:   Isonicotinic acid 99%
Catalog Number: (200000-982)

Supplier:  Acros Organics
Description:   Size: 25GM. CAS Number: 73-22-3.
MSDS SDS

Supplier:  TCI America
Description:   CAS Number: 37031-30-4
MDL Number: MFCD00040504
Molecular Formula: C9H14O6
Molecular Weight: 218.21
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Flash Point (°C): 135
Specific Gravity (20/20): 1.19
Specific rotation [a]20/D: 54 deg (neat)
MSDS SDS
Supplier:  TCI America
Description:   Dimethyl Dipropargylmalonate, Purity: >98.0%(GC), CAS Number: 63104-44-9, Molecular Formula: C11H12O4, Synonym: Dipropargylmalonic Acid Dimethyl Ester, Form: Crystal-Powder, Solid, Color: White - Pale yellow, Size: 5G
MSDS SDS
Supplier:  AMBEED, INC
Description:   1-Boc-4-(Aminomethyl)piperidine, Purity: 97%, CAS Number: 144222-22-0, Appearance: Colorless to pale-yellow liquid or solid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  TCI America
Description:   CAS Number: 121343-82-6
MDL Number: MFCD00237657
Molecular Formula: C20H19NO6
Molecular Weight: 369.37
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Specific rotation [a]20/D: -22 deg (C=1, DMF)
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,065 - 2,080  of 156,421