Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,2-Difluorocyclopropanecarboxylic+acid


153,921  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"153921"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   4-(4-Chlorophenyl)thiazole, Purity: 98%, CAS Number: 1826-22-8, Appearance: Solid, Storage: Sealed in dry, 2-8 deg C, Size: 250mg
Supplier:  AMBEED, INC
Description:   (4S,4'S)-1,1'-Di([1,1'-biphenyl]-4-yl)-4,4'-diisopropyl-4,4',5,5'-tetrahydro-1H,1'H-2,2'-biimidazole ≥97%
New Product
Supplier:  AMBEED, INC
Description:   Iridium-(4,4'-difluoro-2,2'-bipyridine-κN1,κN1')bis[3,5-difluoro-2-(5-trifluoromethyl-2-pyridinyl-κN)phenyl-κC]-hexafluorophosphate ≥97%
New Product
Supplier:  AMBEED, INC
Description:   2,2'-Bis(2-chlorophenyl)-4,4',5,5'-tetraphenyl-1,1'-biimidazole 98%
New Product
Supplier:  AMBEED, INC
Description:   (4-Chloro-3-(4-ethoxybenzyl)phenyl)((3aS,5R,6S,6aS)-6-hydroxy-2,2-dimethyltetrahydrofuro[2,3-d][1,3]dioxol-5-yl)methanone 97%
Catalog Number: (TCT1829-005G)

Supplier:  TCI America
Description:   CAS Number: 22255-22-7
MDL Number: MFCD02093500
Molecular Formula: C17H18O3
Molecular Weight: 270.33
Purity/Analysis Method: >96.0% (GC)
Form: Crystal
Color: White
Melting point (°C): 57
MSDS SDS
Catalog Number: (220025-286)

Supplier:  R&D Systems
Description:   The Recombinant Mouse IL-22 Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-22 Protein has been validated for the following applications: Bioactivity.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   MF=C8H11CLN2OS MW=218.71 CAS=199851-22-4 MDL=MFCD03453082 5G
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 055662-100MG , MDL Number: MFCD15530318
Supplier:  Matrix Scientific
Description:   Potassium-5-ethyl-(2,2-dimethyl-1,3-dioxan-5-ol)trifluoroborate ≥97%
Catalog Number: (TCA0582-025G)

Supplier:  TCI America
Description:   [for Calcium determination]
CAS Number: 1836-22-2
MDL Number: MFCD00046379
Molecular Formula: C17H12N2O9S2
Molecular Weight: 518.35
Form: Crystal
Color: Yellow Red
MSDS SDS
Supplier:  AMBEED, INC
Description:   (R)-3,3'-Bis3,5-bis(trifluoromethyl)phenyl)-5,5',6,6',7,7',8,8'-octahydro-1,1'-bi-2,2'-naphthol, Purity: 98%, CAS Number: 618854-91-4, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 1g
Supplier:  AMBEED, INC
Description:   Sodium 2,2',2''-(1,4,7,10-tetraazacyclododecane-1,4,7-triyl)triacetate, Purity: 97%, CAS Number: 217973-03-0, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 5g
Supplier:  AMBEED, INC
Description:   (R)-N,N'-(1,1'-Binaphthalene]-2,2'-diyl)bis(2-diphenylphosphinobenzamide), Purity: 98% 99%ee, CAS Number: 298695-62-2, Appearance: White to yellow powder or crystals, Storage: Inert atmosphere, 2-8 C, Size: 100mg
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 048602-5G , MDL Number: MFCD12922679
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,849 - 4,864  of 153,921