Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,2-Difluoropropionic+acid


153,749  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"153749"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 034516-500MG , MDL Number: MFCD01936222

Supplier:  MilliporeSigma
MSDS SDS
Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Human IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00003013 Beilstein Registry No.: 752039 Soluble in hot alcohol acetone glacial acetic acid
MSDS SDS

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])

Supplier:  Rockland Immunochemical
Description:   Anti-Guinea Pig IgG Antibody has been assayed against 1.0 µg of Guinea Pig IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (RL603-106-007)

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Chicken IgM in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (RL100-101-237)

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of b -Phosphoglucomutase (Lactococcus lacti) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (RL100-101-228)

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of N-Acyl Mannosamine-1-Dehydrogenase (E.coli Recombinant) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])

Supplier:  Rockland Immunochemical
Description:   Anti-Golden Syrian Hamster IgG has been assayed against 1.0 µg of Hamster IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (101793-076)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 007593-5G , MDL Number: MFCD00001824
Catalog Number: (75928-880)

Supplier:  Rockland Immunochemical
Description:   Interleukin-22 (IL-22) is a cytokine important for the modulation of tissue responses during inflammation (1). Unlike the distantly related IL-10, IL-22 does not inhibit the production of proinflammatory cytokines in monocytes in response to LPS, but it has some inhibitory effects on IL-4 production from Th2 T cells. IL-22 is expressed by both the adaptive arm of the immune system such as CD4 T cell subsets including Th17 cells, as well as by innate lymphocytes such as NK and LTi-like cells (2). IL-22 is highly expressed in several chronic inflammatory conditions, and studies suggest that IL-22 plays both inflammatory and protective roles (3).
Catalog Number: (103007-114)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the mutant form of beta-amyloid, with glycine substituted for glutamic acid at position 22 found in “Arctic” heredity. A toxic soluble beta-amyloid assembly (TA-beta) is formed more rapidly from 'Arctic' beta-amyloid than from wild-type beta-amyloid in the presence of liposomes containing GM1 ganglioside.
Sequence: DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVGGVVIA
MW: 4442.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (RL100-101-231)

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Sucrose Phosphorylase (E.coli) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number: (RL100-101-235)

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Pyranose Oxidase (E.coli) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Rabbit) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,777 - 1,792  of 153,749