Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,4-Dichloro-6-(methoxymethoxy)benzoic+acid


162,486  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"162486"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  AMBEED, INC
Description:   Sodium-DL-2-hydroxybutyrate ≥98%, Ambeed.Inc
New Product
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 25753-15-5, MDL: MFCD09757594
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Stab. with ca 0.2% 2,4-dimethyl-6-tert-butylphenol
MSDS SDS
Supplier:  MORAVEK BIOCHEMICALS MS
Description:   Foscarnet sodium ≥98% (by HPLC), MORpureâ„¢
Supplier:  Anaspec Inc
Description:   This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2
MW: 3357.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C
Supplier:  PeproTech, Inc.
Description:   Human Apo-SAA is a 104 amino acid polypeptide that circulates primarily in association with high-density lipoproteins (HDL). The level of Apo-SAA, normally 1-5 μg/ml in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apolipoprotein. The human SAA gene codes for a 122 amino acid polypeptide, which contains an 18 amino acid N-terminal signal sequence. Recombinant Apo-SAA is a consensus SAA molecule corresponding to human Apo-SAA1α, except for the presence of an N-terminal methionine, the substitution of asparagine for aspartic acid at position 60, and arginine for histidine at position 71 (the latter two substituted residues are present in Apo-SAA2β). The calculated molecular weight of Recombinant Human Apo-SAA is 11.7 kDa.
Supplier:  GE Healthcare - Whatman
Description:   NAB Nanosep® is a low cost alternative to expensive kits that yields quantity and quality of nucleic acid suitable for downstream applications, such as PCR, sequencing, and RE digestion. NAB nanoseps offer various protocols that help the end user save money without sacrificing results.
Supplier:  MilliporeSigma
Description:   Meets ACS Specifications
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 057534-1G , MDL Number: MFCD14708217
Supplier:  MilliporeSigma
Description:   Purified DNA from salmon testes.
Supplier:  Hardy Diagnostics
Description:   Carbol Fuchsin, Kinyoun for AFB stain, for Mycobacteria
Supplier:  Eagle Manufacturing
Description:   For carrying and storing gasoline, oil, benzene, naphtha, and kerosene.

Supplier:  Promega Corporation
Description:   Human mixed male and female Genomic DNA is purified and stored in 10mM Tris-HCl (pH 8.0), 1mM EDTA >90% of the DNA is longer than 50kb in size as measured by pulsed-field gel electrophoresis. The DNA is suitable for Southern blot hybridizations, genomic analysis (including PCR) and genomic library construction. Human Genomic DNA comes from multiple anonymous donors.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   BAPTA tetrasodium salt hydrate is a high quality and sensitive compound for calcium signaling studies(investigation of signal transduction and apoptotic cascades, and neuroscience research).
MSDS SDS
Supplier:  MP Biomedicals
Description:   Albumins are a group of acidic proteins which occur in the body fluids and tissues of mammals and in some plant seeds. Serum and plasma albumin is carbohydrate free and comprises 55-62% of the protein present. However, only about 40% of the total albumin in the body is in the circulating plasma at one time with the remainder being in extracellular spaces with which there is, in general, equilibration about every 24 hours.
Catalog Number: (TS46385-0500)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Potassium hydrogen phthalate for HPLC
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,681 - 5,696  of 162,486