Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2,5-Dibromo-3-(Dibromomethyl)pyridine


140,853  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"140853"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Anaspec Inc
Description:   This is amino acids 11 to 42 fragment of b-amyloid peptide labeled with HiLyteâ„¢ Fluor 488, Abs/Em=503/528 nm. Post-mortem Alzheimer’s diseased (AD) brain specimens reveal significant levels of this b -amyloid peptide within the insoluble amyloid pools. HiLyteâ„¢ Fluor 488-labeled b-amyloid (11-42) has a brighter intensity than FITC or FAM-labeled b-amyloid (11-42).
Sequence: HiLyteâ„¢ Fluor 488-EVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 3692.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Thermo Scientific Chemicals
Description:   Grade: tech. ca 75% w/w aq. soln. . Melting Point C. Boiling Point C: NA. C6H6O3S. 98-11-3. CORROSIVE HARMFUL
MSDS SDS
Supplier:  AMBEED, INC
Description:   STAT3 Inhibitor V, Stattic 98%
New Product
Supplier:  AMBEED, INC
Description:   2-Ethoxybenzoic acid, Purity: 98%, CAS number: 134-11-2, Appearance: Form: liquid / Colour: Colorless - Yellow, Storage: Sealed in dry, Room Temperature, Size: 10G
Supplier:  Matrix Scientific
MSDS SDS
Supplier:  AMBEED, INC
Description:   4-(Diphenylmethylene)-1,1-dimethylpiperidin-1-ium methyl sulfate, Purity: 98%, CAS Number: 62-97-5, Appearance: Form: Crystal - Powder / Colour: White - Almost white, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 50MG
Supplier:  AMBEED, INC
Description:   (trans,trans)-4-(p-Tolyl)-4'-vinyl-1,1'-bi(cyclohexane), Purity: 97%, CAS Number: 155041-85-3, Appearance: Form: Crystal - Powder/Colour: White - Almost white, Storage: Sealed in dry, 2-8 C, Size: 5g
Supplier:  Novus Biologicals
Description:   Cadherin-11 Overexpression Lysate (Adult Normal)
Supplier:  AMBEED, INC
Description:   4-Methyl-6-(methylthio)pyrimidin-2-ol, Purity: 98%, CAS Number: 16710-11-5, Appearance: White to off-white powder or crystals, Storage: Sealed in dry, Room Temperature, Size: 100MG
Supplier:  AMBEED, INC
Description:   2-Methylisonicotinic acid, Purity: 98%, CAS Number: 4021-11-8, Appearance: White to yellow powder or crystals, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 10g
Supplier:  AMBEED, INC
Description:   (R)-2-(2-(2-((3,3-Dibutyl-7-(methylthio)-1,1-dioxido-5-phenyl-2,3,4,5-tetrahydrobenzo[b][1,4]thiazepin-8-yl)oxy)acetamido)-2-phenylacetamido)acetic acid hydrate ≥98%
New Product
Supplier:  AMBEED, INC
Description:   2-Bromo-3-(trifluoromethoxy)pyridine, Purity: 95%, CAS Number: 1206978-11-1, Appearance: Colorless to Yellow Liquid, Storage: Sealed in dry, 2-8C, Size: 100MG
Supplier:  AMBEED, INC
Description:   4-Methylhexanoicacid 98%
Supplier:  Thermo Scientific Chemicals
Description:   . Grade:98, Melting Point C147-148*. Boiling Point C:NA. C6H7N3S. 14294-11-2. HARMFUL
MSDS SDS
Supplier:  Thermo Fisher Scientific
Description:   New plate adapter (max. 11 mm height), Multidrop Dispensers
Supplier:  Strem Chemicals Inc
Description:   BINAP
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,465 - 4,480  of 140,853