Text Search >
2,6-Diaminohex-4-enoic+acid
Print…
You Searched For:
139,405 results were found
2,6-Diaminohex-4-enoic+acid
Catalog Number:
(89512-340)
Supplier:
Abgent
Description:
Western Blot: 1:1000, Immunofluorescence: 1:10~50,
Catalog Number:
(10106-448)
Supplier:
Prosci
Description:
Annexin VI belongs to a family of calcium-dependent membrane and phospholipid binding proteins. Although their functions are still not clearly defined, several members of the annexin family have been implicated in membrane-related events along exocytotic and endocytotic pathways. The annexin VI gene is approximately 60 kbp long and contains 26 exons. It encodes a protein of about 68 kDa that consists of eight 68-amino acid repeats separated by linking sequences of variable lengths. It is highly similar to human annexins I and II sequences, each of which contain four such repeats. Exon 21 of annexin VI is alternatively spliced, giving rise to two isoforms that differ by a 6-amino acid insertion at the start of the seventh repeat. Annexin VI has been implicated in mediating the endosome aggregation and vesicle fusion in secreting epithelia during exocytosis.
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse CSF1 (P07141-1) (Met1-Glu262) was expressed.
Catalog Number:
(103664-862)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse IL2RA (NP_032393.3) extracellular domain (Met 1-Lys 236) was expressed, with a C-terminal polyhistidine tag.
Catalog Number:
(89350-872)
Supplier:
Genetex
Description:
In cardiac tissue brain natriuretic peptide (BNP) is synthesized as 134 amino acid precursor (prepro-BNP), which is cleaved by proteases to form a 26 aa ""signal"" peptide and a 108 aa pro-BNP. Proteolytic digestion of pro-BNP results in formation of 76 aa amino-terminal NT-proBNP and biologically active 32 aa BNP hormone molecule. Both proBNP and NTproBNP circulate in human plasma and have been proposed as markers for early diagnosis of left ventricular dysfunction as well as prognostic markers of possible cardiac complications at patients with heart failure.
Supplier:
Anaspec Inc
Description:
This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) MW:3464.1 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Catalog Number:
(89513-618)
Supplier:
Abgent
Description:
Western Blot: 1:1000
Catalog Number:
(89515-950)
Supplier:
Abgent
Description:
Western Blot: 1:1000
Supplier:
GE Healthcare - Life Sciences
Description:
XK empty columns are designed for liquid chromatography at low to medium pressure. The user friendly design ensures trouble-free operation with fittings for direct connection to high performance liquid chromatography systems. They are compatible with aqueous solutions and most organic solvents used in liquid chromatography of macromolecules. They are not resistant to acetone, ketones, chlorinated hydrocarbons, aliphatic esters and phenol. Should be avoided: >10% NaOH, >10% HCl, >5% acetic acid and strong mineral acids.
Catalog Number:
(103624-336)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human KIR2DL1 (NP_055033.2) extracellular domain (Met 1-His 245) was fused with a polyhistidine tag at the C-terminus.
Catalog Number:
(10301-348)
Supplier:
Bioss
Description:
Zinc-finger proteins contain DNA-binding domains and have a wide variety of functions, most of which encompass some form of transcriptional activation or repression. The majority of zinc-finger proteins contain a Krüppel-type DNA binding domain and a KRAB domain, which is thought to interact with KAP1, thereby recruiting histone modifying proteins. Zinc finger and BTB domain-containing protein 26 (ZBTB26), also known as ZNF481, is a 441 amino acid member of the Krüppel C2H2-type zinc-finger protein family. Localized to the nucleus, ZBTB26 contains a BTB domain, also known as a POZ domain, which inhibits DNA binding and mediates homotypic and heterotypic dimerization. Characteristics of the BTB domain suggest that ZBTB26 functions as a transcription regulator.
Catalog Number:
(10072-610)
Supplier:
Prosci
Description:
BMPs (Bone Morphogenetic Proteins) belong to the TGF-beta superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis and is expressed in a variety of tissues including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains.
Supplier:
AMBEED, INC
Description:
Hydroxypropyl Methacrylate, Purity: 97% +(stabilized with MEHQ), CAS Number: 27813-02-1, Appearance: Colorless to Yellow Liquid, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100G
Supplier:
PeproTech, Inc.
Description:
BMPs (Bone Morphogenetic Proteins) belong to the TGF-β superfamily of structurally related signaling proteins. BMP-2 is a potent osteoinductive cytokine, capable of inducing bone and cartilage formation in association with osteoconductive carriers such as collagen and synthetic hydroxyapatite. In addition to its osteogenic activity, BMP-2 plays an important role in cardiac morphogenesis, and is expressed in a variety of tissues, including lung, spleen, brain, liver, prostate ovary and small intestine. The functional form of BMP-2 is a 26 kDa protein composed of two identical 114 amino acid polypeptide chains linked by a single disulfide bond. Each BMP-2 monomer is expressed as the C-terminal part of a precursor polypeptide, which also contains a 23 amino acid signal sequence for secretion, and a 259 amino acid propeptide. After dimerization of this precursor, the covalent bonds between the propeptide (which is also a disulfide-linked homodimer) and the mature BMP-2 ligand are cleaved by a furin-type protease. Recombinant Human BMP-2 is a 26.0 kDa homodimeric protein consisting of two 115 amino acid polypeptide chains. Manufactured using all Animal-Free reagents.
Catalog Number:
(PAV3143)
Supplier:
Promega Corporation
Description:
Bisacrylamide, Molecular Grade, is a cross-linking agent used in the preparation of polyacrylamide gels. This product is tested for its efficiency in gel polymerization.
Catalog Number:
(103665-306)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the extracellular domain of mouse SDC1 (NP_035649.1) (Met 1-Glu 252) was expressed, with a C-terminal polyhistidine tag.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
