Text Search >
3-(3-Azetidinyloxy)pyridine+dihydrochloride
Print…
You Searched For:
33,994 results were found
3-(3-Azetidinyloxy)pyridine+dihydrochloride
Catalog Number:
(103359-140)
Supplier:
Novus Biologicals
Description:
The p38 beta / MAPK11 Antibody from Novus Biologicals is a rabbit polyclonal antibody to p38 beta / MAPK11. This antibody reacts with human, mouse, rat. The p38 beta / MAPK11 Antibody has been validated for the following applications: Western Blot.
Supplier:
TCI America
Description:
CAS Number: 303127-79-9
Molecular Formula: C26H30O10 Molecular Weight: 502.52 Purity/Analysis Method: >96.0% (HPLC) Form: Crystal Melting point (°C): 160 Specific rotation [a]20/D: -22 deg (C=1, CHCl3) Storage Temperature: 0-10°C
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041445-1G , MDL Number: MFCD00237540
Catalog Number:
(10330-052)
Supplier:
Bioss
Description:
This gene encodes the beta C chain of inhibin, a member of the TGF-beta superfamily. This subunit forms heterodimers with beta A and beta B subunits. Inhibins and activins, also members of the TGF-beta superfamily, are hormones with opposing actions and are involved in hypothalamic, pituitary, and gonadal hormone secretion, as well as growth and differentiation of various cell types.
Catalog Number:
(TCM1480-5G)
Supplier:
TCI America
Description:
CAS Number: 138906-41-9
MDL Number: MFCD06797125 Molecular Formula: C27H27NO11 Molecular Weight: 541.51 Purity/Analysis Method: >98.0% (HPLC) Form: Crystal Melting point (°C): 149 Specific rotation [a]20/D: 54 deg (C=1, CHCl3) Storage Temperature: <0°C
Supplier:
AMBEED, INC
Description:
Methyl-1,2,3,4-tetra-O-acetyl-β-D-glucuronate 98%
Catalog Number:
(10362-508)
Supplier:
Bioss
Description:
IKK Alpha/IKK beta is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number:
(103230-102)
Supplier:
Novus Biologicals
Description:
IkB-beta, Polyclonal Antibody, Host: Goat, Species: Human, Mouse, Isotype: IgG, Immunogen: E. coli-derived recombinant mouse I kappa B-beta Met1-Ala359, Synonyms: beta, IkappaBbeta, I-kappa-B-beta, ikB-B, IkB-beta, Application: Western Blotting, Size: 25UG
Catalog Number:
(102192-566)
Supplier:
Novus Biologicals
Description:
The TGF-beta 2 Antibody from Novus Biologicals is a rabbit polyclonal antibody to TGF-beta 2. This antibody reacts with human. The TGF-beta 2 Antibody has been validated for the following applications: Western Blot.
Catalog Number:
(103339-436)
Supplier:
Novus Biologicals
Description:
The Beta-1,3-N-Acetylglucosaminyltransferase 2 / B3GNT2 Antibody (1A8) from Novus Biologicals is a mouse monoclonal antibody to Beta-1,3-N-Acetylglucosaminyltransferase 2 / B3GNT2. This antibody reacts with human. The Beta-1,3-N-Acetylglucosaminyltransferase 2 / B3GNT2 Antibody (1A8) has been validated for the following applications: Western Blot, ELISA.
Catalog Number:
(102120-814)
Supplier:
Novus Biologicals
Description:
The beta-3 Adrenergic R / ADRB3 Antibody from Novus Biologicals is a goat polyclonal antibody to beta-3 Adrenergic R / ADRB3. This antibody reacts with human. The beta-3 Adrenergic R / ADRB3 Antibody has been validated for the following applications: Western Blot, Peptide ELISA.
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of mouse and rat beta-amyloid. It differs from human beta-amyloid by three amino acid residues: Arg5, Tyr10, and His13. Residues in human beta-amyloid correspond to Gly5, Phe10, and Arg13 in mice and rat sequence.
Sequence: DAEFGHDSGFEVRHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight: 4418 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(75788-818)
Supplier:
Prosci
Description:
Human beta -Nerve Growth Factor ( beta -NGF) was initially isolated in the mouse submandibular gland. It is composed of three non-covalently linked subunits alpha, beta , and gamma ; it exhibits all the biological activities ascribed to NGF. It is structurally related to BDNF, NT-3 and NT-4 and belongs to the cysteine-knot family of growth factors that assume stable dimeric structures. beta -NGF is a neurotrophic factor that signals through its receptor beta -NGF, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. beta -NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. These results suggest that beta -NGF is a pleiotropic cytokine, which in addition to its neurotropic activities may have an important role in the regulation of the immune system. Human beta -NGF shares 90% sequence similarity with mouse protein and shows cross-species reactivity.
Catalog Number:
(102123-716)
Supplier:
Novus Biologicals
Description:
The Spectrin beta 3 Antibody [DyLight 650] from Novus Biologicals is a rabbit polyclonal antibody to Spectrin beta 3. This antibody reacts with human. The Spectrin beta 3 Antibody [DyLight 650] has been validated for the following applications: Immunohistochemistry, Immunoprecipitation.
Catalog Number:
(10116-124)
Supplier:
Prosci
Description:
Polyclonal antibody Il12 beta Host: Goat Target Species: human immunogen: Il12 beta antibody was raised against a 12 amino acid synthetic peptide near the internal region of Il12 beta. Application: ELISA, WB, IF
Catalog Number:
(102868-830)
Supplier:
R&D Systems
Description:
The Recombinant Mouse TGF-beta 2 Protein from R&D Systems is derived from CHO. The Recombinant Mouse TGF-beta 2 Protein has been validated for the following applications: Bioactivity.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
