Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-(4-Chloro-2-hydroxyphenoxy)acetic+acid


169,841  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"169841"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10358-784)

Supplier:  Bioss
Description:   Indole-3-acetic acid, also known as IAA, is a heterocyclic compound that is an phytohormones called auxins. This colourless solid is probably the most important plant auxin. The molecule is derived from indole, containing a carboxymethyl group (acetic acid). IAA has many different effects, as all auxins do, such as inducing cell elongation and cell division with all subsequent results for plant growth and development. There are less expensive and metabolically stable synthetic auxin analogs on the market for use in horticulture, such as indole-3-butyric acid (IBA) and 1-naphthaleneacetic acid (NAA).
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Dess-Martin periodinane 15% (w/w) in dichloromethane, AcroSeal™
Supplier:  Matrix Scientific
Description:   MF=C11H16Clno2 MW=229.71 Cas=17841-69-9 1G
Supplier:  Burdick & Jackson
Description:   For HPLC, liquid and gas chromatography, pesticide residue analysis, spectophotometry, organic synthesis and combinatorial chemistry.
MSDS SDS

Supplier:  Electron Microscopy Sciences
Description:   Aniline Blue Electron Microscopy Sciences solution is a prepared, ready-to-use, high quality staining solutions for standard staining procedures used by the Biological Staining Commission and the Armed Forces Institute of Pathology. Available in concentrations of 2.5% in 2% Acetic Acid, Phosphomolybdic Acid Solution, and with Orange G.
Minority or Woman-Owned Business Enterprise
Supplier:  MP Biomedicals
Description:   Soluble in methanol, acetic acid, DMSO. Stock solutions of 1 mM (2 mg/6.48 mL) in methanol are stable for approximately 1 month at -20 °C. Stock solutions can be diluted to 1:100 (10 µM solution) just before use. Working solutions should be made fresh each day.
Supplier:  Thermo Scientific Chemicals
Description:   6-Chloro-2-fluoronicotinic acid, Purity: 95%, CAS number: 1211578-46-9, Molecular Formula: C6H3ClFNO2, synonym: 6-Chloro-2-fluoropyridine-3-carboxylic acid, Size: 250mg
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Phenylcyanoacetic acid ethyl ester. Grade: 98, Melting Point C. Boiling Point C: 274-275*. C11H11NO2. 4553-07-5.
MSDS SDS

Supplier:  AMBEED, INC
Description:   Ethyl 3-(benzylamino)-3-oxopropanoate, Purity: 97%, CAS Number: 29689-63-2, Appearance: Form: Crystal - Powder/Colour: Very pale yellow - Pale yellow, Storage: Sealed in dry, Room Temperature, Size: 1g
Supplier:  TCI America
Description:   CAS Number: 30379-55-6
MDL Number: MFCD00274211
Molecular Formula: C9H10O3
Molecular Weight: 166.18
Purity/Analysis Method: >97.0% (GC,T)
Form: Clear Liquid
Boiling point (°C): 155
Flash Point (°C): 113
Specific Gravity (20/20): 1.17
MSDS SDS
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier:  MilliporeSigma
Description:   N, N-Diphenylacetamide for synthesis, Cas Number: 519-87-9, Synonyms: Acetic acid diphenylamide, Chemical formula: CH3CON(C6H5)2.
Supplier:  AMBEED, INC
Description:   Ethyl 3-(2,6-Dichloro-5-fluoro-3-pyridyl)-3-oxopropionate, Purity: 97%, CAS Number: 96568-04-6, Appearance: White to off-white powder, Storage: Sealed in dry, Store in freezer, under -20 C, Size: 5g
Supplier:  AMBEED, INC
Description:   (±)-α-Methoxyphenylacetic acid 98%
Supplier:  Thermo Scientific Chemicals
Description:   CAS No.: 31362-50-2
Molecular Formula: C71H110N24O18S
Formula Weight: 1619.90
Storage Temperature: 2°C to 8°C
Physical Form: Powder
Appearance: White
Solubility: Soluble in 0.05M acetic acid (20mg/ml)
Merck Reference: 14,1329
MDL No.: MFCD00167514
MSDS SDS
Supplier:  AMBEED, INC
Description:   2,5-Dioxopyrrolidin-1-yl 2-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-yl)acetate, Purity: 97%, CAS Number: 55750-61-3, Appearance: Form: Crystal - Powder, Storage: Inert atmosphere, Store in freezer, under -20C, Size: 5G
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
4,465 - 4,480  of 169,841