Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

5-Chloro-2-fluoro-2'-methyl-1,1'-biphenyl


39,101  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"39101"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Enzo Life Sciences
Description:   Synthetic peptide corresponding to amino acid residues [12-25] + Cys-NH2 of human heme oxygenase-1. Complementary peptide to rabbit polyclonal antibody (BML-HC3001) for use in control experiments. Preincubation of antibody with this peptide abolishes the antibody reactivity with HO-1 protein.

Supplier:  Bioss
Description:   This gene belongs to the cytokine gene family which encode secreted proteins involved in immunoregulatory and inflammatory processes. The protein encoded by this gene is structurally related to the CXC (Cys-X-Cys) subfamily of cytokines. Members of this subfamily are characterized by two cysteines separated by a single amino acid. This cytokine displays chemotactic activity for monocytes but not for lymphocytes, dendritic cells, neutrophils or macrophages. It has been implicated that this cytokine is involved in the homeostasis of monocyte-derived macrophages rather than in inflammation. [FUNCTION] Potent chemoattractant for neutrophils, and weaker for dendritic cells. Not chemotactic for T-cells, B-cells, monocytes, natural killer cells or granulocytes. Does not inhibit proliferation of myeloid progenitors in colony formation assays.
Supplier:  Biotium
Description:   This conjugate is prepared by labeling F(ab’)2 fragment of goat anti-rabbit IgG (H+L) with CFâ„¢640R dye. CFâ„¢ dyes offer advantages in brightness, photostability, and specificity compared to other fluorescent dyes. Far-red fluorescent CFâ„¢640R (Ex/Em 642/662 nm) is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647, and has exceptional photostability.

Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Supplier:  Biotium
Description:   This conjugate is prepared by labeling F(ab’)2 fragment of goat anti-rabbit IgG (H+L) with CFâ„¢555 dye. CFâ„¢ dyes offer advantages in brightness, photostability, and specificity compared to other fluorescent dyes. Orange-red fluorescent dye CFâ„¢555 (Ex/Em 555/565 nm) is brighter than Cy®3 and an excellent replacement for Alexa Fluor® 555 for antibody conjugates.

Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®3 is a registered trademark of GE Healthcare.

Supplier:  AAT BIOQUEST INC
Description:   DiTOâ„¢-3 is chemically equivalent to TOTO®-3 (TOTO® is the trademark of Invitrogen).
Small Business Enterprise Minority or Woman-Owned Business Enterprise

Supplier:  Rockland Immunochemical
Description:   Secondary Antibody is designed for immunofluorescence microscopy, fluorescence based plate assays (FLISA) and fluorescent western blotting. Brighter than Alexa and Cy dye conjugates. 100ug
Supplier:  AMBEED, INC
Description:   Boc-O-benzyl-L-β-homothreonine 95+%
Supplier:  Bachem Americas
Description:   Potential impurity of octreotide.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the amino acid residues (Met 1-Cys 213) of the human IL2 receptor α chain (NP_000408.1) precursor was expressed with C-terminal fused human IgG1 Fc region.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041640-1G , MDL Number: MFCD00063354
Supplier:  Bachem Americas
Description:   The somatostatin analog CTOP is a very potent and highly selective ligand for µ-opioid receptors. CTOP shows only little interaction with other opioid receptor systems.
Supplier:  TLC PHARMACEUTICAL STANDARD LTD
Description:   Pharmaceutical Standards, Nortriptyline EP Impurity B HCl (Cyclobenzaprine USP Related Compound B, N-Desmethyl Cyclobenzaprine HCl)

Supplier:  Biotium
Description:   Polyclonal anti-GST reacts with glutathione-S transferase (GST), a common expression tag used in molecular biology. This conjugate is prepared by labeling polyclonal goat anti-GST IgG (H+L) with CFâ„¢640R dye. CFâ„¢640R (Ex/Em 642/662 nm) is a novel far-red rhodamine-based dye spectrally similar to Cy®5 and Alexa Fluor® 647. CFâ„¢640R is much brighter than Cy®5 and at least as bright as Alexa Fluor® 647 when excited at 633 or 635 nm. However, the most important advantage of CFâ„¢640R is its exceptional photostability.

Alexa Fluor® is a registered trademark of Thermo Fisher Scientific. Cy®5 is a registered trademark of GE Healthcare.
Supplier:  Sino Biological
Description:   A DNA sequence encoding the mouse IFNG (P01580) (Met 1-Cys 155) was fused with the Fc region of human IgG1 at the C-terminus.
Supplier:  Anaspec Inc
Description:   This is cysteine-modified N-terminus of Beta-Amyloid (1-42).
Cysteine modification of beta-amyloid peptides enables specific immobilization via maleimide-terminated surface at the N-terminal cysteine to the mica surface usually used in AFM interaction studies. Since the N-terminal is not involved in fibril formation, certain studies have adopted this strategy of immobilizing the peptide using the maleimide-cystein linkage/functionalization and study Beta-Amyloid interactions.
Sequence: CDAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA
Molecular Weight: 4617.3 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Catalog Number: (103003-382)

Supplier:  Anaspec Inc
Description:   A glutathione-derived heavy metal-detoxifying peptide of higher plants consisting of 4 units of gammaGlu-Cys.
Sequence:(γE-C)4-G
MW:1004.1 Da
% peak area by HPLC:95
Storage condition:-20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1 - 16  of 39,101