Text Search >
1-Bromo-3,5-dimethoxybenzene
Print…
You Searched For:
140,332 results were found
1-Bromo-3,5-dimethoxybenzene
Supplier:
Thermo Scientific Chemicals
Description:
2-Amino-3-fluorobenzeneboronic acid pinacol ester, 96%
Supplier:
Anaspec Inc
Description:
This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) MW:3464.1 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Supplier:
AOB CHEM USA
Description:
2-(3,5-Dibromophenyl)-4,4,5,5-tetramethyl-1,3,2-dioxaborolane ≥97%
Catalog Number:
(TCD3748-25G)
Supplier:
TCI America
Description:
CAS Number: 15307-86-5
Molecular Formula: C14H11Cl2NO2 Molecular Weight: 296.15 Purity/Analysis Method: >98.0% (GC,T) Form: Crystal Melting point (°C): 158
Supplier:
AMBEED, INC
Description:
Methyl (E)-cinnamate, Purity: 95%, CAS number: 1754-62-7, Appearance: Form: crystalline Colour: white to light yellow, Storage: Sealed in dry, Room Temperature, Size: 100G
Catalog Number:
(10072-414)
Supplier:
Prosci
Description:
IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-beta/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant murine IL-22 is a 33.4 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.
Catalog Number:
(75791-604)
Supplier:
Prosci
Description:
Interleukin-1 receptor antagonist protein (Il1rn), also known as IL-1ra, IRAP or IL1 inhibitor, is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1 alpha (IL1A) and interleukin 1 beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses. The mouse Il1rn gene encodes a 178 amino acids (aa) protein with a 26 aa signal peptide. Mouse Il1rn protein shares 26% and 19% identity with its homologues IL-1 beta and IL-1 alpha, respectively. Il1rn can Inhibits the activity of interleukin-1 by binding to receptor IL1R1 and preventing its association with the coreceptor IL1RAP for signaling, but has no interleukin-1 like activity. Recently, an recombinant human Il1rn protein is used in the treatment of rheumatoid arthritis, an autoimmune disease in which IL-1 plays a key role.
Catalog Number:
(EM1.01574.1000)
Supplier:
PeproTech, Inc.
Description:
IL-19 belongs to the IL-10 family of regulatory cytokines, which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Preliminary data suggests that IL-19 is a proinflammatory cytokine, because it up-regulates IL-6 and TNF-α, and induces apoptosis through TNF-α. IL-19 signals through the type I IL-20R. Human and murine IL-19 share 71% amino acid sequence identity. Recombinant Human IL-19 is a 35.8 kDa homodimer of two 154 amino acid chains. In solution, IL-19 exists predominantly as a non-disulfide-linked dimer.
Catalog Number:
(101912-574)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 057158-100G , MDL Number: MFCD00007598
Catalog Number:
(10072-848)
Supplier:
Prosci
Description:
IL-22 is a member of the IL-10 family of regulatory cytokines which includes IL-10, IL-19, IL-20, IL-22, IL-24 and IL-26. Members of this family share partial homology in their amino acid sequences, but they are dissimilar in their biological functions. Produced by T lymphocytes, IL-22 inhibits IL-4 production by Th2 cells, and induces acute phase reactants in the liver and pancreas. IL-22 signals through a receptor system consisting of IL-10R-β/CRF2-4 and IL-22R, both of which are members of the class II cytokine-receptor family. Recombinant human IL-22 is a 33.6 kDa non-disulfide-linked homodimeric protein containing of two 146 amino acid polypeptide chains.
Catalog Number:
(76065-814)
Supplier:
Prosci
Description:
For WB starting dilution is: 1:1000
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
