2-[(3-Methoxypropyl)amino]isonicotinic+acid
Catalog Number:
(103624-290)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human KIR2DL4 (ADY38409.1)(Met1-His242) was expressed with six amino acids (LEVLFQ) at the C-terminus was expressed and purified.
Catalog Number:
(10072-854)
Supplier:
Prosci
Description:
IL-17D is a disulfide-linked homodimer of two 185 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17D has the ability to stimulate the production of IL-6, IL-8, and GM-CSF and inhibits hemopoiesis of myeloid progenitor cells in colony forming assays. Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains.
Catalog Number:
(PAH5032)
Supplier:
Promega Corporation
Description:
EDTA, Disodium Salt, Molecular Biology Grade, is a chelator of divalent metal cations.
Catalog Number:
(103634-062)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the ROR1 (NP_005003.2) (Met1-Glu403) was expressed with six amino acids (LEVLFQ) at the C-terminus. The purified protein was biotinylated <i>in vitro</i>.
Catalog Number:
(103009-726)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (45-73) is a 29-amino acid long peptide derived from the Exon 2/Insert 1 domain.
Sequence:ESPLQTPTEDGSEEPGSETSDAKSTPTAE MW:2977.97 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(75788-758)
Supplier:
Prosci
Description:
Insulin-like growth factor I (IGF1) belongs to the family of insulin-like growth factors that are structurally homologous to proinsulin. Mature IGFs are generated by proteolytic processing of inactive precursor proteins, which contains the N- and C-terminal propeptide regions. Mature human IGF-I consisting of 70 amino acids has 94% identity with mouse IGF-I and exhibits cross-species activity. IGF-1 binds IGF-IR, IGF-IIR, and the insulin receptor and plays a key role in cell cycle progression, cell proliferation and tumor progression. IGF-1 expression is regulated by growth hormone. R3 IGF-1 is an 83 amino acid analog of IGF-1 comprising the complete human IGF-1 sequence with the substitution of an Arg (R) for the Glu(E) at position three, hence R3, and a 13 amino acid extension peptide at the N terminus. R3 IGF-1 has been produced with the purpose of increasing biological activity. R3 IGF-1 is significantly more potent than human IGF-I in vitro.
Catalog Number:
(75789-356)
Supplier:
Prosci
Description:
Leukocyte-Associated Immunoglobulin-Like Receptor 2 (LAIR2) is a secreted, 131 amino acid protein that contains one Ig-like C2 type domain, making it a member of the Ig superfamily. When compared to LAIR-1, its transmembrane counterpart, it shares 83% amino acid identity across the signal sequence and extracellular domains; although one is secreted and one is membrane-bound, the two LAIR proteins are thought to have arisen from a common gene ancestor and appear to share similar adhesion profiles. This suggests that LAIR-2 may compete with LAIR-1 for ligand binding. A 114 amino acid alternate splice form of LAIR-2 is truncated at the C terminus, but retains the entire Ig domain. The expression profile of these splice forms, and the presence of orthologs in other species, have not been reported.
Catalog Number:
(75788-864)
Supplier:
Prosci
Description:
Human Interleukin 7 (IL-7) is a potent lymphoid cell growth factor stimulating the proliferation of lymphoid progenitors. IL7 can associate with the hepatocyte growth factor (HGF) to form a hybrid cytokine that functions as a pre-pro-B cell growth-stimulating factor. Human IL7 cDNA encodes a 177 amino acid precursor protein containing a 25 amino acid signal peptide and a 152 amino acid mature protein. Human and mouse IL7 share 65% sequence identity in the mature region and both exhibit cross-species activity. IL-7 signals via IL-7 receptor (IL7R) activating multiple pathways including JaK/STAT and PI3K/AKT, which regulate lymphocyte survival, glucose uptake, proliferation, and differentiation. IL-7 is also associated with cytoplasmic IL2-R gamma for signal transduction.
Catalog Number:
(76796-868)
Supplier:
AMBEED, INC
Description:
(Z)-2-(2-Aminothiazol-4-yl)-2-(tert-Butoxycarbonylmethoxyimino)acetic acid, Purity: 98%, CAS Number: 74440-02-1, Appearance: White to off-white powder or crystals, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 10G
Supplier:
AMBEED, INC
Description:
3-[N-Tris(hydroxymethyl)methylamino]-2-hydroxypropanesulfonic Acid, Purity: 99%, CAS Number: 68399-81-5, Appearance: Form: Crystal - PowderColour: White - Almost white, Storage: Keep in dark place, Inert atmosphere, Room temperature, Size: 100G
Supplier:
MP Biomedicals
Description:
Ethylenediamine Tetraacetic Acid is a polyamino carboxylic acid hexadentate ligand and a chelating agent.
Catalog Number:
(103005-970)
Supplier:
Anaspec Inc
Description:
A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35) MW:3996 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10450-490)
Supplier:
Bioss
Description:
Catalyzes the first reaction in the catabolism of the essential branched chain amino acids leucine, isoleucine, and valine. May also function as a transporter of branched chain alpha-keto acids.
Catalog Number:
(101934-084)
Supplier:
Matrix Scientific
Description:
MF=C17H27N3O2 MW=305.42 ,250Mg
Catalog Number:
(103624-356)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human UBE2M (P61081) (Met 1-Lys 183) was expressed and purified, with additional two amino acids (Gly and Pro) at the N-terminus.
Catalog Number:
(101803-986)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 016058-500MG , MDL Number: MFCD04039876
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||