Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-[(4-Pyridinylmethyl)amino]isonicotinic+acid


163,894  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163894"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10113-916)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: CHN2 antibody was raised against an 11 amino acid synthetic peptide near the C-Terminus of CHN2, Tested Applications: ELISA
Catalog Number: (10114-214)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: PCSK5 antibody was raised against a 15 amino acid synthetic peptide near the internal region of PCSK5; Applications: ELISA
Catalog Number: (10114-306)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: AIFM3 antibody was raised against a 15 amino acid synthetic peptide near the internal region of AIFM3; Applications: ELISA
Catalog Number: (10114-334)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Immunogen: TNC antibody was raised against a 14 amino acid synthetic peptide near the internal region of TNC; Applications: ELISA
Catalog Number: (10112-064)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: PTF1a antibody was raised against a 14 amino acid synthetic peptide near the internal region of PTF1a, Application: ELISA
Supplier:  Bioss
Description:   Cleaves C-terminal amino acids linked to proline in peptides such as angiotensin II, III and des-Arg9-bradykinin. This cleavage occurs at acidic pH, but enzymatic activity is retained with some substrates at neutral pH.

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 28 fragment of the b-amyloid peptide biotinylated on the side chain of lysine.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNK-K(Biotin)-NH2
Molecular Weight: 3616 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   5-(tert-Butoxycarbonylamino)-1-pentanol 98%
New Product

Supplier:  Biotium
Description:   This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:  Biotium
Description:   This antibody recognizes a polypeptide which is identified as insulin, a 51-amino acid polypeptide composed of A and B chains connected through the C-peptide. Proinsulin, which has very little biological activity, is cleaved by proteases within its cell of origin into the insulin molecule and the C-terminal basic residue. Insulin enhances membrane transport of glucose, amino acids, and certain ions. It also promotes glycogen storage, formation of triglycerides, and synthesis of proteins and nucleic acids. Deficiency of insulin results in diabetes mellitus. The main storage site for insulin is the pancreatic islets. Antibodies to insulin are important as beta-cell and insulinoma marker.
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Contains 147 amino acids.
Supplier:  Sino Biological
Description:   Derp10 Protein, Species: D. Pteronyssinus, Purity: > 90% as determined by SDS-PAGE, Expressed Host: E. Coli, Predicted N Terminal: Arg 19, Molecular mass: consists of 284 amino acids and predicts a molecular mass of 32.9 kDa, Size: 250uG

Supplier:  APOLLO SCIENTIFIC
Description:   4-(Methylsulfonylamino)benzeneboronic acid 95%
Supplier:  TCI America
Description:   CAS Number: 480452-05-9
Molecular Formula: C9H20N2O2
Molecular Weight: 188.27
Purity/Analysis Method: >98.0% (GC,T)
Form: Clear Liquid
Specific Gravity (20/20): 0.98
MSDS SDS
Catalog Number: (TS44114-5000)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   (R)-N-Fmoc-α-methylvaline 98%, 98% ee
Supplier:  PeproTech, Inc.
Description:   IL-8 is a proinflammatory CXC chemokine that can signal through the CXCR1 and CXCR2 receptors. It is secreted by monocytes and endothelial cells. IL-8 chemoattracts and activates neutrophils. Recombinant Human IL-8 (CXCL8) (monocyte-derived) is an 8.4 kDa protein containing 72 amino acid residues.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,681 - 7,696  of 163,894