Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-[(4-Pyridinylmethyl)amino]isonicotinic+acid


164,286  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"164286"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (10114-888)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat; Target Species: Human; Immunogen: CNN3 antibody was raised against a 15 amino acid synthetic peptide near the C-Terminus of CNN3; Applications: ELISA,Western blotting
Catalog Number: (10116-902)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: Ymer antibody was raised against a 15 amino acid synthetic peptide near the internal region of Ymer; Application: ELISA, IHC
Catalog Number: (10112-788)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: Orexin Receptor 2 antibody was raised against a 13 amino acid synthetic peptide near the N-Terminus of Orexin Receptor 2, Application: ELISA, WB
Catalog Number: (10112-596)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Species: Human, Immunogen: FABP2 antibody was raised against a 12 amino acid synthetic peptide near the C-Terminus of FABP2, Application: ELISA, WB, IHC
Catalog Number: (103667-928)

Supplier:  Sino Biological
Description:   UCHL3 recombinant protein, Purity: > 97 % as determined by SDS-PAGE, Host: E. Coli, Species: Mouse, Molecular mass: The recombinant mouse UCHL3 consisting of 240 amino acids and has a calculated molecular mass of 27.
Supplier:  BeanTown Chemical
Description:   CAS: 99-31-0; EC No: 202-748-5; MDL No: MFCD00002522 Powder; Molecular Formula: C8H7NO4; MW: 181.15 Melting Point: <gt/>300°
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 302-84-1
MDL Number: MFCD00064223
Molecular Formula: C3H7NO3
Molecular Weight: 105.09
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 240
MSDS SDS
Catalog Number: (10113-752)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: TFAP2D antibody was raised against a 13 amino acid synthetic peptide near the internal region of TFAP2D, Tested Applications: ELISA
Catalog Number: (10112-054)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: PSD3 antibody was raised against a 15 amino acid synthetic peptide near the internal region of PSD3 (aa 395-409), Application: ELISA
Catalog Number: (10116-800)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Human; Immunogen: SRD5A1 antibody was raised against a 13 amino acid synthetic peptide near the N-Terminus of SRD5A1; Application: ELISA, IHC
Catalog Number: (10113-070)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: Forkhead Box I2 antibody was raised against an 11 amino acid synthetic peptide near the C-Terminus of Forkhead Box I2, Application: ELISA
Catalog Number: (10113-442)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: SDCCAG8 antibody was raised against a 15 amino acid peptide near the internal region of SDCCAG8 (aa469-483), Tested Applications: ELISA, WB
Catalog Number: (10112-910)

Supplier:  Prosci
Description:   Polyclonal, Host: Goat, Immunogen: TEB4 antibody was raised against a 13 amino acid synthetic peptide near the internal region of TEB4 (aa 886-898), Application: ELISA
Catalog Number: (102998-454)

Supplier:  Anaspec Inc
Description:   A 32-amino acid long peptide with a disulfide bridge between Cys1 and Cys7 and C-terminal amidated Proline, Calcitonin (CT) is involved plasma calcium level. Compared to human or rat calcitonin, Salmon Calcitonin (sCT) is more potent in its biological actions such as inhibition of osteoclasts resorption of bones, renal ion excretion modulation, and others. The reason for its potency has been attributed to the fact that sCT forms an amphipathic helix in its amino acids 9-19 region.
Sequence: CSNLSTCVLGKLSQELHKLQTYPRTNTGSGTP-NH2 (Disulfide bridge: 1-7)
MW: 3431.9 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Bioss
Description:   Immunoglobulins belong to a group of related glyco proteins which make up 20% of serum proteins. Antigens and immunoglobulins react to confer immunity to individuals. Immunoglobulins have similar structures of two identical heavy chains and two identical light chains. Both the heavy chains and the light chains are divided into constant and variable regions. The constant regions have the same amino acid sequences between all the immunoglobulin classes. The variable regions have approximately 110 amino acids with high sequence variability. The amino acid sequence of the heavy chain determines the class of an immunoglobulin. The five types of immunoglobulin heavy chains are known as: IgG, IgA, IgM, IgD, and IgE. IgG is divided into four subclasses, and IgA is divided into two subclasses. In serum IgA and IgG are monomers with a single 4 polypeptide unit; while, IgM is a pen tamer. IgA may also form polymers. Kappa light chain antibody can be used for the identification of leukemias, plasmacytomas and certain non Hodgkin's lymphomas. Kappa light chain contains one immunoglobulin like domain. The EU sequence has the INV allotypic marker, Ala 45 and Val 83. The ROY sequence has the INV allotypic marker, Ala 45 and Leu 83.
Supplier:  Genetex
Description:   Rabbit polyclonal antibody to DOPA Decarboxylase
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
9,201 - 9,216  of 164,286