Text Search >
5-Phenyl-2-(trifluoromethyl)-3-furoic+acid
Print…
You Searched For:
174,388 results were found
5-Phenyl-2-(trifluoromethyl)-3-furoic+acid
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
DL-Leucine 99+%
Supplier:
Adipogen
Description:
AMCA-X SE is an amine-reactive, UV-excitable, blue fluorescent dye.
Catalog Number:
(103003-050)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
LGC STANDARDS
Description:
[2-[(2-Amino-4-chlorophenyl)amino]phenyl](4-methyl-1-piperazinyl)methanone, TRC, LGC Standards
Catalog Number:
(103003-048)
Supplier:
Anaspec Inc
Description:
Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7) MW: 3920.5 Da % Peak Area by HPLC: ≥ 95% Storage condition: -20°C
Supplier:
AMBEED, INC
Description:
N-(4-Aminobenzoyl)-β-alanine 98%
Catalog Number:
(76262-708)
Supplier:
Rockland Immunochemical
Description:
xCT belongs to the amino acid-polyamine-organocation (APC) superfamily and L-type amino acid transporter (LAT) family. xCT gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. Increased expression of this gene results in neuronal cell death. xCT may be associated with kaposi sarcoma, dyscalculia, cystinuria, spondylolsis, and anemia of prematurity. Anti-xCT Antibody is useful for researchers interested in Cancer Research, Glucose/Energy Metabolism Research, and Cell Surface Protein Interaction Research.
Catalog Number:
(76262-706)
Supplier:
Rockland Immunochemical
Description:
xCT belongs to the amino acid-polyamine-organocation (APC) superfamily and L-type amino acid transporter (LAT) family. xCT gene encodes a member of a heteromeric, sodium-independent, anionic amino acid transport system that is highly specific for cysteine and glutamate. In this system, designated Xc(-), the anionic form of cysteine is transported in exchange for glutamate. Increased expression of this gene results in neuronal cell death. xCT may be associated with kaposi sarcoma, dyscalculia, cystinuria, spondylolsis, and anemia of prematurity. Anti-xCT Antibody is useful for researchers interested in Cancer Research, Glucose/Energy Metabolism Research, and Cell Surface Protein Interaction Research.
Supplier:
PeproTech, Inc.
Description:
SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal trucation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Human SDF-1β (CXCL12) is an 8.5 kDa protein containing 72 amino acid residues.
Catalog Number:
(10257-530)
Supplier:
Bioss
Description:
Semaphorins are a family of cell surface and secreted proteins that are conserved from insects to humans. Members of this family of proteins are approximately 750 amino acids in length (including signal sequences) and are defined by a conserved extracellular “semaphorin†domain of approximately 500 amino acids containing 14-16 cysteines, blocks of conserved sequences and no obvious repeats. The transmembrane semaphorins are characterized by an additional 80 amino acid transmembrane domain and an 80-110 amino acid cytoplasmic domain. Secreted and cell-bound semaphorins chemically attract and repel the growth of neural axons, guiding the development of intricate networks of neural tissue. SEMA4B (semaphorin-4B), also known as SemC or SEMAC, is an 832 amino acid single-pass type I membrane protein that belongs to the semaphorin family and exists as two alternatively spliced isoforms. Containing one Ig-like C2-type (immunoglobulin-like) domain, a PSI domain and a single sema domain, SEMA4B is encoded by a gene located on human chromosome 15.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042440-1G , MDL Number: MFCD02094111
Catalog Number:
(TS25430-0010)
Supplier:
THERMO FISHER SCIENTIFIC CHEMICALS
Description:
D-(-)-Cysteine 99%
Catalog Number:
(EM8.14986.0050)
Supplier:
PeproTech, Inc.
Description:
SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal truncation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Rat SDF-1β (CXCL12) is an 8.4 kDa protein containing 72 amino acid residues.
Supplier:
Bachem Americas
Description:
Sequence: Fmoc-Arg(Tos)-OH
Supplier:
Spectrum Chemicals
Description:
(1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
