Text Search >
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Print…
You Searched For:
174,368 results were found
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Catalog Number:
(76482-958)
Supplier:
AAT BIOQUEST INC
Description:
The analysis of amino acids, ions, metabolites and other small molecules is frequently hindered by the interference of lipids, protein and enzymes present in biofluids, cell and tissue lysates.
Supplier:
PeproTech, Inc.
Description:
FGF-acidic is one of 23 known members of the FGF family. Proteins of this family play a central role during prenatal development, postnatal growth and regeneration of a variety of tissues, by promoting cellular proliferation and differentiation. FGF-acidic is a non-glycosylated heparin binding growth factor that is expressed in the brain, kidney, retina, smooth muscle cells, bone matrix, osteoblasts, astrocytes and endothelial cells. FGF-acidic has the ability to signal through all the FGF receptors. Recombinant Human FGF-acidic is a 16.8 kDa protein consisting of 141 amino acid residues.
Catalog Number:
(103008-568)
Supplier:
Anaspec Inc
Description:
This sequence is amino acids 1 to 20 of influenza A virus hemagglutinin protein (HA2) connected to a 10 amino acid cell permeable HIV Trans-Activator of Transcription (TAT) protein transduction domain (PTD). TAT-HA2 is capable of being used as a large macromolecule drug delivery peptide. The TAT PTD binds to the cell surface and penetrates the membrane via lipid raft-dependent macropinocytosis. Endosomal escape and transduction of the fusion peptide are enhanced by the HA2 domain, which is a pH-sensitive lipid membrane destabilizing sequence.
Sequence: RRRQRRKKRGGDIMGEWGNEIFGAIAGFLG MW: 3433 Da % Peak area by HPLC: 95 Storage condition: -20°C
Catalog Number:
(10072-082)
Supplier:
Prosci
Description:
Oncostatin M (OSM) is a growth and differentiation factor that participates in the regulation of neurogenesis, osteogenesis and hematopoiesis. Produced by activate T cells, monocytes and Kaposi’s sarcoma cells, OSH can exert both stimulatory and inhibitory effects on cell proliferation. It stimulates the proliferation of fibroblasts, smooth muscle cells and Kaposi’s sarcoma cells, but, inhibits the growth of some normal and tumor cell lines. It also promotes cytokine release (e.g. IL-6, GM-CSF and G-CSF) from endothelial cells, and enhances the expression of low-density lipoprotein receptor in hepatoma cells. OSM share several structural and functional characteristics with LIF, IL-6, and CNTF. Human OSM is active on murine cells. The human OSM gene encodes for a 252 amino acid polypeptide, containing 25 amino acid signal sequence for secretion and a 227 precursor protein. Proteolytic processing of this precursor removes an 18 amino acid C-terminal peptide and generates the mature OSM form. Recombinant human Oncostatin M is a 23.9 kDa protein, containing 209 amino acid residues.
Supplier:
ALADDIN SCIENTIFIC
Description:
H-Deg-OH ≥98%
Supplier:
PeproTech, Inc.
Description:
IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.
Supplier:
Thermo Scientific Chemicals
Description:
MDL: MFCD00064225
Beilstein Registry No.: 1910407
Supplier:
PeproTech, Inc.
Description:
SDF-1α and β are stromal-derived, CXC chemokines that signal through the CXCR4 receptor. SDF-1α and β chemoattract B and T cells, and have been shown to induce migration of CD34+ stem cells. Additionally, the SDF-1 proteins exert HIV-suppressive activity in cells expressing the CXCR4 receptor. Human and murine SDF-1 proteins act across species. SDF-1α and β contain the four highly conserved cysteine residues present in CXC chemokines. The mature SDF-1β protein, produced by an N-terminal truncation of two additional amino acids, after removal of the signal sequence, contains 72 amino acid residues. Recombinant Rat SDF-1β (CXCL12) is an 8.4 kDa protein containing 72 amino acid residues.
Catalog Number:
(89142-924)
Supplier:
Enzo Life Sciences
Description:
Glutamate receptor ligand.
Catalog Number:
(10361-038)
Supplier:
Bioss
Description:
Glycophorins A, B and C are sialoglycoproteins of the human erythrocyte membrane, which bear the antigenic determinants for the MN, Ss and Gerbich blood groups, respectively. Glycophorins span the membrane once and present their amino-terminal end to the extracellular surface of the human erythrocyte. The genetic array of expressed glycophorin surface antigens on erythrocytes defines the blood group phenotype of the individual. The human Glycophorin A gene maps to chromosome 4q31.21, contains seven exons which are 97% homologous to Glycophorin B, and encodes a 150 amino acid protein. The human Glycophorin B gene maps to chromosome 4q31.21 and encodes a 91 amino acid protein. The human Glycophorin C gene maps to chromosome 2q14.3 and contains four exons. Glycophorin C transcript can generate two protein isoforms. Isoform 1 includes all 4 exons and encodes the full length 128 amino acid protein. Isoform 2 is missing exon 2 and encodes a 109 amino acid protein, which specifies the Yus subtype of the Gerbich phenotype.
Catalog Number:
(102599-126)
Supplier:
Chem Impex International
Description:
Crosslinking agent for compounds carrying an amino group
Catalog Number:
(F-2520.0001BA)
Supplier:
Bachem Americas
Description:
Sequence: H-p-Chloro-D-Phe-OH
Supplier:
Thermo Scientific Chemicals
Description:
Amido Black 10B, Electrophoresis Reagent.
Supplier:
Adipogen
Description:
Potent inhibitor of ethylene synthesis in plants acting at the level of 1-aminocyclopropanecarboxylic acid synthase.
Catalog Number:
(75790-154)
Supplier:
Prosci
Description:
Calumenin is a secreted calcium-binding protein that belongs to the CREC family. Calumenin contains six EF-hand domains and is expressed at high levels in the heart, placenta and skeletal muscle. Human Calumenin is synthesized as a 315 amino acid precursor that contains a 19 amino acid signal sequence, and a 296 amino acid mature chain. Calumenin localizes to the endoplasmic reticulum (ER) and sarcoplasmic reticulum (SR) of mammalian tissues which plays a role in ER functions as protein folding and sorting. Calumenin is involved in the regulation of vitamin K-dependent carboxylation of multiple N-terminal glutamate residues. It seems to inhibit gamma -carboxylase GGCX.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
