Text Search >
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Print…
You Searched For:
174,443 results were found
2-[Bis(2-hydroxyethyl)amino]ethanesulphonic+acid
Catalog Number:
(103624-262)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the human BNIP3L (NP_004322.1) (Ser 2-Lys 187) was expressed and purified, with additional two amino acids (Gly and Pro) at the N-terminus.
Catalog Number:
(76303-716)
Supplier:
PeproTech, Inc.
Description:
Myostatin is a TGF-beta family member that acts as an inhibitor of skeletal muscle growth. This muscle-specific cytokine interacts with Activin type I and type II receptors, and suppresses myoblast proliferation by arresting cell-cycle in the G1 phase. Suppression of myostatin activity facilitates muscle formation, and may be useful in reducing and/or preventing adiposity and type-2 diabetes. Myostatin activity can be blocked by the activin-binding protein follistatin, and by the propeptide of myostatin. Recombinant Human/Murine/Rat Myostatin is a 25.0 kDa protein consisting of two identical 109 amino acid polypeptides linked by a single disulfide bond. The amino acid sequence of mature myostatin is extremely conserved across species, and is the same in murine, rat, chicken, turkey, porcine, and human. Myostatin is expressed as the C-terminal part of a precursor polypeptide, which also contains a short N-terminal signal sequence for secretion, and a propeptide of 243 amino acids. After dimerization of this precursor, the covalent bonds between the propeptide and the mature ligand are cleaved by furin-type proteases. However, the resulting two proteins remain associated through non-covalent interactions, and are secreted as a latent complex.
Supplier:
PeproTech, Inc.
Description:
IL-17E is a disulfide-linked homodimer of two 145 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region, but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17E stimulates secretion of IL-8, and induces activation of the transcription factor NF-κB in cells that express the IL-17BR receptor. Recombinant Human IL-17E is a 33.8 kDa disulfide-linked homodimer of two 146 amino acid polypeptide chains.
Supplier:
PeproTech, Inc.
Description:
RELMα belongs to a unique family of tissue-specific cytokines termed FIZZ (found in inflammatory zone) and RELM. The four known members of this family, resistin, RELMα, RELMβ, and RELMγ, are 85-94 amino acid, secreted proteins sharing a conserved C-terminal domain, characterized by 10 cysteine residues with a unique spacing motif of C-X11-C-X8-C-X-C-X3-C-X10-C-X-C-X-C-X9-C-C. RELMα and resistin are secreted exclusively by adipocytes, while RELMβ is expressed in the epithelium of the colon and small bowel. The physiological role and molecular targets of RELMα are still unknown. Recombinant Murine RELMα is a 10.0 kDa monomeric protein containing 89 amino acid residues.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 041995-250MG , MDL Number: MFCD02682285
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042089-250MG , MDL Number: MFCD02682583
Catalog Number:
(103009-742)
Supplier:
Anaspec Inc
Description:
TAU proteins belong to the microtubule-associated protein (MAP) family and are involved in the pathogenesis of Alzheimer’s disease. In the human brain, there are six TAU isoforms ranging from 352 to 441 amino acids in length. These isoforms vary at the carboxyl terminal according to the presence of either three repeat or four repeat domains (R1-R4), in addition to the presence or absence of one or two insert domains at the amino-terminus. Tau Peptide (306-336) is a 31-amino acid long peptide derived from the Repeat 3 domain.
Sequence:VQIVYKPVDLSKVTSKCGSLGNIHHKPGGGQ MW:3248.51 Da % peak area by HPLC:95 Storage condition:-20° C
Catalog Number:
(10751-410)
Supplier:
Prosci
Description:
FXYD7 Antibody: FXYD7 is a member of a family of small membrane proteins that share a 35-amino acid signature sequence domain, beginning with the sequence PFXYD and containing seven invariant and six highly conserved amino acids. The FXYD proteins are tissue-specific regulators of Na, K-ATPase, with FXYD7 initially identified as a brain-specific member. FXYD7 interacts with Na, K-ATPase through its transmembrane domain and is thought to influence the affinity of Na, K-ATPase for external K+ and Na+ ions. Other members of the FXDY family have similar functions: FXYD2 regulates the properties of Na, K-ATPase, while FXYD1 (phospholemman), FXYD3 (MAT-8), FXYD4 (CHIF), and FXYD5 (RIC) have been shown to induce channel activity in experimental expression systems.
Supplier:
REVACC INC
Description:
A recombinant form of the receptor binding domain (RBD) with amino acids 319 to 541) of the spike (S) glycoprotein gene from SARS-CoV-2 bearing mutations identified in variant of Omicron BA.2, was produced by insect cells, followed by purification.
Catalog Number:
(103665-528)
Supplier:
Sino Biological
Description:
A DNA sequence encoding the mouse Tnfrsf4 (NP_035789.1) (Met1-Pro211) was expressed with six amino acids (LEVLFQ) at the C-terminus.
Supplier:
AMBEED, INC
Description:
N-(tert-Butoxycarbonyl)-L-valine N'-methoxy-N'-methylamide 95%
Catalog Number:
(95022-962)
Supplier:
HiMedia
Description:
For investigating the carbon and nitrogen requirements of yeasts.
Catalog Number:
(77976-327)
Supplier:
LGC STANDARDS
Description:
(S)-cis,trans-Abscisic Acid Glucosyl Ester, TRC, LGC Standards
Supplier:
TCI America
Description:
CAS Number: 1152-61-0
MDL Number: MFCD00002719 Molecular Formula: C12H13NO6 Molecular Weight: 267.24 Purity/Analysis Method: >99.0% (T) Form: Crystal Melting point (°C): 116 Specific rotation [a]20/D: 9.5 deg (C=7, AcOH)
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
