Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Sodium+methotrexate


169,674  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"169674"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (TS32783-0010)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Tricine 99+% for biochemistry
Supplier:  G-Biosciences
Description:   Ponceau S is a rapid and reversible stain for detecting protein bands on Western blot membranes and can be used with PVDF, nitrocellulose and cellulose acetate membranes*. Ponceau S is a negative stain, which binds to the positively charged amino groups of the protein and it also binds non‐covalently to non‐polar regions in the protein.
MSDS SDS
Supplier:  Honeywell Research Chemicals
Description:   Ethylenediaminetetraacetic acid di-sodium salt-2-hydrate, Purity: 99-101%, Grade: Analytical, CAS: 6381-92-6, MF: C10H14N2Na2O8.2H2O, Molar mass: 372.24 g/mol, Container Type: Poly bottle, PH: 4-5 for complexometry, Size: 1KG
MSDS SDS
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 028944-500MG , MDL Number: MFCD00435056
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 044029-5G , MDL Number: MFCD06199354
Supplier:  MilliporeSigma
Description:   ( {N-[tris(Hydroxymethyl)methyl]glycine}). White solid. A zwitterionic amino acid commonly used in gel electrophoresis systems. Purity: >98% by titration. Heavy metals: <1 ppm. pKa 8.2 at 20[degree] C. CAS 5704-04-1, M.W. 179.2.
Supplier:  AMBEED, INC
Description:   1-(2-((4-Bromophenyl)amino)-2-oxoethyl)piperidine-4-carboxamide 98%
New Product
Catalog Number: (101929-070)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 065135-500MG , MDL Number: MFCD00037783
Catalog Number: (10427-808)

Supplier:  Bioss
Description:   AARE (Acylamino-acid-releasing enzyme) is also known as Acyl-peptide hydrolase. It catalyzes the hydrolysis of the terminal acetylated amino acid preferentially from small acetylated peptides. The acetyl amino acid formed by this hydrolase is further processed to acetate and a free amino acid by an aminoacylase. It can play an important role in destroying oxidatively damaged proteins in living cells. Deletions of this gene locus corresponding to the protein are found in various types of carcinomas, including small cell lung carcinoma and renal cell carcinoma.
Supplier:  TCI America
Description:   CAS Number: 615-82-7
MDL Number: MFCD00021729
Molecular Formula: C8H16N2O3
Molecular Weight: 188.23
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Supplier:  Matrix Scientific
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C8H6F3No2 MW=205.14 MDL=MFCD01631415 1G
MSDS SDS
Supplier:  MilliporeSigma
Description:   (Gly). White crystalline solid. Purity: >99% by assay. Soluble in H2O. RTECS MB7600000, CAS 56-40-6, M.W. 75.1. WARNING! May be carcinogenic/teratogenic.
Supplier:  AMBEED, INC
Description:   2-(2-Amino-5-bromophenyl)acetonitrile, Purity: 98%, CAS Number: 882855-95-0, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 100MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 043174-1G , MDL Number: MFCD08276931
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
2,737 - 2,752  of 169,674
Prev