Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Amino-4-hydroxybenzoic+acid


164,466  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"164466"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AVANTOR PERFORMANCE MATERIALS US
Description:   For Laboratory,Research,or Manufacturing Use
MSDS SDS
Catalog Number: (10072-854)

Supplier:  Prosci
Description:   IL-17D is a disulfide-linked homodimer of two 185 amino acid polypeptide chains. It belongs to the IL-17 family of structurally-related cytokines that share a highly conserved C-terminal region but differ from one another in their N-terminal regions and in their distinct biological roles. The six known members of this family, IL-17A through IL-17F, are secreted as homodimers. IL-17D has the ability to stimulate the production of IL-6, IL-8, and GM-CSF and inhibits hemopoiesis of myeloid progenitor cells in colony forming assays. Recombinant human IL-17D is a 40.5 kDa disulfide-linked homodimer of two 185 amino acid polypeptide chains.
Catalog Number: (103008-022)

Supplier:  Anaspec Inc
Description:   This peptide is Histone H3 amino acid residues 1 to 10 mono-methylated at Lys-9.
Sequence:TKQTAR-K(Me1)-STGGKAPR
MW:1600.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Promega Corporation
Description:   Recombinant human FLT1 (amino acids 784-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. FLT1, also known as fms-like tyrosine kinase 1, is a member of the VEGFR family and is related to the oncogene ROS.
Catalog Number: (10451-480)

Supplier:  Bioss
Description:   Required for the function of light chain amino-acid transporters. Involved in sodium-independent, high-affinity transport of large neutral amino acids such as phenylalanine, tyrosine, leucine, arginine and tryptophan. Involved in guiding and targeting of LAT1 and LAT2 to the plasma membrane. When associated with SLC7A6 or SLC7A7 acts as an arginine/glutamine exchanger, following an antiport mechanism for amino acid transport, influencing arginine release in exchange for extracellular amino acids. Plays a role in nitric oxide synthesis in human umbilical vein endothelial cells (HUVECs) via transport of L-arginine. Required for normal and neoplastic cell growth. When associated with SLC7A5/LAT1, is also involved in the transport of L-DOPA across the blood-brain barrier, and that of thyroid hormones triiodothyronine (T3) and thyroxine (T4) across the cell membrane in tissues such as placenta. Involved in the uptake of methylmercury (MeHg) when administered as the L-cysteine or D,L-homocysteine complexes, and hence plays a role in metal ion homeostasis and toxicity. When associated with SLC7A5 or SLC7A8, involved in the cellular activity of small molecular weight nitrosothiols, via the stereoselective transport of L-nitrosocysteine (L-CNSO) across the transmembrane. Together with ICAM1, regulates the transport activity LAT2 in polarized intestinal cells, by generating and delivering intracellular signals. When associated with SLC7A5, plays an important role in transporting L-leucine from the circulating blood to the retina across the inner blood-retinal barrier.

Supplier:  Bioss
Description:   This gene encodes a protein with limited similarity to L-amino acid oxidase which contains the conserved amino acids thought to be involved in catalysis and binding of flavin adenine dinucleotide (FAD) cofactor. The expression of this gene can be induced by interleukin 4 in B cells, however, expression of transcripts containing the first two exons of the upstream gene is found in other cell types. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Apr 2012].
Supplier:  ALADDIN SCIENTIFIC
Description:   AT-406 ≥98%, Moligandâ„¢
New Product
Supplier:  Anaspec Inc
Description:   PYY is a 36-amino acid regulatory gut hormone present in endocrine cells in the intestine. This peptide acts both as an endocrine and a paracrine agent.
Sequence:YPIKPEAPGEDASPEELNRYYASLRHYLNLVTRQRY-NH2
MW:4309.8 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli</i>. Contains 121/242 amino acids.
Supplier:  Bachem Americas
Description:   Sequence: H-β-(3-Benzothienyl)-Ala-OH
Supplier:  Enzo Life Sciences
Description:   Produced in <i>E. coli.</i> Contains 154 amino acids.
Supplier:  Promega Corporation
Description:   Recombinant human InsR (amino acids 1011-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. InsR is the insulin receptor tyrosine kinase that is involved in insulin signaling.
Supplier:  Thermo Scientific Chemicals
Description:   5g CAS: 62965-35-9, MDL: MFCD00065574
MSDS SDS
Catalog Number: (10286-458)

Supplier:  Bioss
Description:   ACAA1 is a 424 amino acid member of the thiolase family of enzymes and is involved in lipid metabolism. Localized to the peroxisome, ACAA1 catalyzes the conversion of acyl-CoA and acetyl-CoA to 3-oxoacyl-CoA in the fatty acid oxidation pathway. ACAA1 shows high enzymatic activity in liver, kidney, intestine and white adipose tissue in rats, where it exists as two types, namely type A and type B. Human ACAA1 shares 86% amino acid identity with its rat counterpart, suggesting a conserved function for ACAA1 among different species.
Catalog Number: (IC1680149)

Supplier:  MP Biomedicals
Description:   L(+)-Glutamine
Supplier:  AAT BIOQUEST INC
Description:   Aspartate aminotransferase (AST), also called serum glutamic oxaloacetic transaminase (GOT), is a member of transferase family.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,921 - 7,936  of 164,466