Text Search >
2-Amino-5-cyanobenzoic+acid
Print…
You Searched For:
164,202 results were found
2-Amino-5-cyanobenzoic+acid
Catalog Number:
(10112-062)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Mouse, Immunogen: PTF1a antibody was raised against an 11 amino acid synthetic peptide near the internal region of PTF1a,Application: ELISA, WB
Catalog Number:
(10114-148)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: Desmoglein 1 antibody was raised against a 15 amino acid synthetic peptide near the internal region of Desmoglein 1, Tested Applications: ELISA
Catalog Number:
(10113-472)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species Reactivity: Human, Mouse, Immunogen: RIF1 antibody was raised against a 14 amino acid peptide near the C Terminus of RIF1, Tested Applications: ELISA, WB
Catalog Number:
(10113-242)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species Reactivity: Human, Immunogen: BAG5 antibody was raised against a 13 amino acid synthetic peptide near the N-Terminus of BAG5, Tested Applications: ELISA, WB
Catalog Number:
(10671-736)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(10671-756)
Supplier:
Bioss
Description:
Members of the class-III pyridoxal-phosphate-dependent aminotransferase family, such as AGXT2, catalyze the conversion of glyoxylate to glycine using L-alanine as the amino donor. AGXT2 protects from asymmetric dimethylarginine (ADMA)-induced inhibition in nitric oxide (NO) production. Elevated blood concentrations of ADMA, a methyl derivate of the amino acid arginine and an endogenous inhibitor of nitric oxide (NO) synthase, is produced by the physiological degradation of methylated proteins and is found in association with diabetes, hypertension, congestive heart failure and atherosclerosis. AGXT2L2 (alanine-glyoxylate aminotransferase 2-like 2) is a 450 amino acid pyridoxal phosphate that exists as a homotetramer. Belonging to the class-III pyridoxal-phosphate-dependent aminotransferase family, AGXT2L2 localizes to the mitochondria and exists as three alternatively spliced isoforms. Encoded by a gene located on human chromosome 5q35.3, AGXT2L2 may have similar functions as AGXT2.
Catalog Number:
(10409-222)
Supplier:
Bioss
Description:
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq].
Catalog Number:
(76109-470)
Supplier:
Bioss
Description:
Arginase I which is expressed almost exclusively in the liver, catalyzes the conversion of arginine to ornithine and urea . The human arginase I gene, which maps to chromosome 6q23, encodes a 322 amino acid protein. Arginase I exists as a homotrimeric protein and contains a binuclear manganese cluster. Arginase II catalyzes the same reaction as arginase I, but differs in its tissue specificity and subcellular location. Specifically, arginase II localizes to the mitochondria. Arginase II is expressed in non-hepatic tissues, with the highest levels of expression in the kidneys, but, unlike arginase I, is not expressed in liver. The human arginase II gene, which maps to chromosome 14q24.1-q24.3, encodes a 354 amino acid protein. In addition, arginase II contains a putative amino-terminal mitochondrial localization sequence.
Catalog Number:
(77976-046)
Supplier:
LGC STANDARDS
Description:
Perfluorononanoic acid 13C9 50 µg/mL in Methanol:Water, Dr. Ehrenstorfer, LGC Standards
Supplier:
Adipogen
Description:
Probe for the colorimetric determination of boron in samples such us soils, plants, composts, manure, water, nutirent solution, glass or steel (microgram levels of boron). It forms an orange complex with boron in aqueous solution (absorption maxima at ~415nm). The detection range of boron in sample solutions is 1.0-6ppm. To detect boron in plant samples EDTA is used to mask copper, iron and aluminium ions. It is also used in electrocyclization reactions in the synthesis of martinellic acid, spirotryprostatin A and benzodiazepinones. Was shown to produce free radicals and might have anti-malarial and anti-cancer properties.
Supplier:
Anaspec Inc
Description:
This 32 amino acid peptide contains a 17 amino acid ring structure that is common to all natriuretic peptides. It is also called the brain natriuretic peptide (BNP) because it was first identified in porcine brain; however, the main source of this peptide is not the brain but the cardiac ventricle. This cardiac neurohormone is secreted from the ventricles in response to volume expansion and pressure overload. It has natriuretic and vasodilatory effects and suppresses the renin-angiotensin-aldosterone system.
Sequence:SPKMVQGSGCFGRKMDRISSSSGLGCKVLRRH (Disulfide bridge: 10-26) MW:3464.1 Da %Peak area by HPLC:≥95% Storage condition: -20°C
Catalog Number:
(10113-768)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Immunogen: Psp antibody was raised against a 13 amino acid synthetic peptide near the internal region of Psp, Tested Applications: ELISA
Catalog Number:
(10113-584)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Immunogen: DNAH11 antibody was raised against a 10 amino acid synthetic peptide near the Internal region of DNAH11, Tested Applications: ELISA
Catalog Number:
(10113-182)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Immunogen: SOX9b antibody was raised against a 13 amino acid synthetic peptide near the internal region of SOX9b, Tested Applications: ELISA
Catalog Number:
(10072-876)
Supplier:
Prosci
Description:
CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NT-1/ BSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.5 kDa protein consisting of 201 amino acid residues.
Supplier:
Matrix Scientific
Description:
EGTA (ethylene glycol bis(2-aminoethyl ether)-N,N,N',N'-tetraacetic acid) ≥99%
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
