Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Amino-5-cyanobenzoic+acid


162,439  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"162439"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Enzo Life Sciences
Description:   Calcium dye
Supplier:  LGC STANDARDS
Description:   (R)-Amino Carnitine, TRC, LGC Standards
New Product
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-D-allo-Thr-OH
Supplier:  PeproTech, Inc.
Description:   CTACK is a keratinocyte-derived CC chemokine which signals through the CCR10 receptor. Both CTACK and CCR10 are expressed in normal and irritated epithelial cells. CTACK selectively attracts CLA+ T-cells and directs them into the skin. CTACK contains the four highly conserved cysteine residues present in most CC chemokines. The mature protein contains 88 amino acid residues. Recombinant Human CTACK (CCL27) is a 10.2 kDa protein containing 88 amino acid residues.
Catalog Number: (103007-258)

Supplier:  Anaspec Inc
Description:   This peptide is the N-Ethyl-maleimide-sensitive factor (NSF) inhibitor fusion polypeptide composed of 11-amino acid cell permeable HIV transactivating regulatory protein (TAT) domain fused to a 22 amino acid NSF domain. TAT-NSF700 inhibits thrombin-induced exocytosis of endothelial cells in a dose-responsive manner.
Sequence: YGRKKRRQRRR-GGG-LLDYVPIGPRFSNLVLQALLVL
MW: 4167 Da
% Peak area by HPLC: 95
Storage condition: -20°C
Catalog Number: (82022-860)

Supplier:  G-Biosciences
Description:   G-Biosciences' HPG (p-hydroxyphenylglyoxal) specifically reacts with arginine residues under mild conditions (pH 7 to 9, 25°C) to yield spectrophotometrically measurable signal for amino acid detection.
Supplier:  Bachem Americas
Description:   Sequence: H-Tyr-OBzl
Supplier:  PeproTech, Inc.
Description:   IL-23 is a proinflammatory, heterodimeric protein composed of two subunits: a unique p19 subunit, and a p40 subunit that is shared with IL-12. IL-23 is secreted by activated dendritic cells and macrophages, and signals though a receptor comprised of IL-23R complexed with IL-12Rβ2. IL-23 has been shown to enhance proliferation of memory T cells. It also stimulates the production of IFN-γ in NK cells, induces IL-17 production, and drives Th17-mediated responses. Recombinant Human IL-23 is a 53.5 kDa, heterodimeric protein consisting of the two subunits, p19 (170 amino acids) and p40 (306 amino acids).
Supplier:  AMBEED, INC
Description:   (S)-2-Amino-5-guanidinopentanoic acid hydrochloride, Purity: 98+%, CAS Number: 1119-34-2, Appearance: Form: Crystal - Powder/Colour: White, Storage: Inert atmosphere, Room Temperature, Size: 1000g
Catalog Number: (101785-900)

Supplier:  Matrix Scientific
Description:   MF=C9H8F3No2 MW=219.16 Cas=261952-26-5 MDL=MFCD01631414 1G
MSDS SDS
Supplier:  Matrix Scientific
Description:   MF=C23H22N2O3 MW=374.44 CAS=132388-58-0 MDL=MFCD00190757 5G
Supplier:  Bachem Americas
Description:   Sequence: H-Orn(Boc)-OH
Supplier:  Thermo Scientific Chemicals
Description:   D-Glutamic acid 1-benzyl ester, Purity: 95%, Cas No: 79338-14-1, Molecular Formula: C12H15NO5, Synonym:H-D-Glu-Obzl, (R)-4-Amino-5-(benzyloxy)-5-oxopentanoic acid, 25g
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   a-Boc-L-ornithine, 95%
MSDS SDS

Supplier:  Enzo Life Sciences
Description:   Produced in E. coli. A non-glycoylated protein containnig 53 amino acids.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,257 - 6,272  of 162,439