Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Amino-5-cyanobenzoic+acid


163,459  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"163459"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  LGC STANDARDS
Description:   Docosahexaenoic Acid N-Succinimide, TRC, LGC Standards
New Product
Supplier:  Bachem Americas
Description:   Sequence: H-Glu(OBzl)-OH
Supplier:  BeanTown Chemical
Description:   CAS: 63-91-2; EC No: 200-568-1; MDL No: MFCD00064227; RTECS: AY7535000 Crystalline; Molecular Formula: C9H11NO2; MW: 165.19 Melting Point: 270-275° (decomposes) Optical Rotation: [α]20/D -34±0.5°, c = 2% in water
MSDS SDS
Catalog Number: (77747-526)

Supplier:  AMBEED, INC
Description:   CBR-5884 ≥99%
New Product
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-β-(2-thienyl)-Ala-OH
Synonym(s): Fmoc-Thi-OH
Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Supplier:  Novus Biologicals
Description:   DBT Overexpression Lysate (Adult Normal)
Catalog Number: (77561-092)

Supplier:  Sino Biological
Description:   The 39 amino acids of PDKtide peptide sequence ([protein fragment, 39 aa]) is derived from two human proteins: residues 1-14 are based on AKT1 (307-320) and residues 16-39 are based on PKN2/PRK2 (961-984).
New Product
Supplier:  ALADDIN SCIENTIFIC
Description:   2-Aminoterephthalic acid can be used to synthesize:· Lanthanide coordination polymers with 1,10-phenanthroline by hydrothermal method.· Blue-emitting derivatives of 2-aminoterephthalic acid.· Amino-functionalized Zr-terephthalate (UiO-66), an excellent catalyst for selective synthesis of jasminaldehyde.· IRMOF-3, a zinc aminoterephthalate metal-organic framework useful as a catalyst for the Knoevenagel condensation of benzaldehyde and ethyl cyanoacetate.· Polymeric composite membrane with excellent CO2 separation capabilities.
New Product
Supplier:  Biotium
Description:   This MAb recognizes granulocyte-colony stimulating factor (G-CSF) in the cytoplasm of mature granulocytes. It shows no reactivity with any other cell types. Markers of myeloid cells are useful in the identification of different levels of cellular differentiation. It reacts with early precursor and mature forms of myeloid cells. It is useful for the detection of myeloid leukemias and granulocytic sarcomas. It can be used as a marker of granulocytes in normal tissues or inflammatory processes.G-CSF is a pleiotropic cytokine that influences differentiation, proliferation and activation of the neutrophilic granulocyte lineage. The human G-CSF cDNA encodes a 207 amino acid precursor containing a 29 amino acid signal peptide that is proteolytically cleaved to form a 178 amino acid residue mature protein. Two G-CSF's, which are identical except for a three amino acid deletion in the amino-terminus of one form of the protein have been isolated from human cells. Murine and human G-CSF's share 73% sequence identity at the amino acid level.

CF® dyes are Biotium's next-generation fluorescent dyes. CF®488A is a green fluorescent dye (Ex/Em 490/515 nm) with excellent brightness and photostability. The dye is minimally charged for less non-specific binding. CF®488A also is compatible with super-resolution imaging by TIRF.
Catalog Number: (10099-656)

Supplier:  Prosci
Description:   ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191ZNF444 has a domain structure and amino acid sequence similar to several zinc finger transcription factors, such as Kruppel-like ZNF191 (MIM 194534).
Supplier:  AMBEED, INC
Description:   (S)-N-3-Cyanophenylalanine 98%
Supplier:  AMBEED, INC
Description:   Fmoc-3,4-dichloro-L-phenylalanine 95%
Supplier:  Spectrum Chemicals
Description:   Xanthane Hydride, Purity: 95%, Cas number: 6846-35-1, Molecular Formula: C2H2N2S3, Molecular Weight: 150.23, Color/Form: Yellow, Yellowish red solid crystal powder, Synonym: Xanthahydrogen, Isoperthiocyanic Acid, Size: 100GM
MSDS SDS
Supplier:  AMBEED, INC
Description:   (S)-4-(1-(3-(Difluoromethyl)-1-methyl-5-(3-(trifluoromethyl)phenoxy)-1H-pyrazole-4-carboxamido)ethyl)benzoic acid, Purity: 99%, CAS Number: 1369489-71-3, Appearance: Solid, Storage: Sealed in dry, 2-8C, Size: 5MG
Catalog Number: (76010-072)

Supplier:  Prosci
Description:   Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are thought to be among the first proteins that appeared in evolution. Arginyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family. [provided by RefSeq].
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,497 - 6,512  of 163,459