Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Amino-5-cyanobenzoic+acid


162,286  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"162286"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AAT BIOQUEST INC
Description:   The FMK peptides are potent, cell permeable, irreversible capase inhibitors.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-Pen(Trt)-OH
Catalog Number: (102551-664)

Supplier:  Matrix Scientific
Description:   N-6-[(BENZYLOXY)CARBONYL]-L-LYSINE MF=C14H20N2O4 MW=280.33 CAS=1155-64-2 MDL=MFCD00002638
Supplier:  Thermo Scientific Chemicals
Description:   1g CAS: 93-85-6, MDL: MFCD00054180
MSDS SDS

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Catalog Number: (103007-440)

Supplier:  Anaspec Inc
Description:   This is 22 amino acids flagellin peptide known as flg2. It spans the core domain necessary for binding and biological activity in plant cells. This peptide spanning the 22 amino acids in the core of the conserved domain induces responses after treatment with fungal elicitors such as chitin fragments, xylanase, ergosterol, and high-mannose–type glycopeptides when applied in subnanomolar concentrations. Flagellin is the structural protein that forms the major portion of flagellar filaments. Flagellins from different bacterial species vary in their central part but show conservation of their N-terminal and C-terminal regions.
Sequence:QRLSTGSRINSAKDDAAGLQIA
MW:2272.5 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  LGC STANDARDS
Description:   2-[[(3aR,4S,6R,6aS)-6-[[5-Amino-6-chloro-2-(propylthio)-4-pyrimidinyl]amino]tetrahydro-2,2-dimethyl-4H-cyclopenta-1,3-dioxol-4-yl]oxy]ethanol, TRC, LGC Standards
New Product
Supplier:  Sino Biological
Description:   DERF1 Protein, Recombinant (His Tag), Purity: > 90 % as determined by SDS-PAGE, Expressed Host: HEK293 Cells, Species: Dermatophagoides farinae, Molecular mass: consists of 314 amino acids and molecular mass of 35.9 kDa, Size: 250uG
Supplier:  Sino Biological
Description:   A DNA sequence encoding the human HDAC4 (NP_006028.2)(Met612-Leu1084) was expressed and purified with two additional amino acids (Gly and Pro ) at the N-terminus.
Supplier:  Bioss
Description:   Kallikrein 9, also known as Kallikrein-Like 3 (KLK-L3), is a chymotrypsin-like serine proteinase. Kallikrein 9 was discovered as the locus for kallikreins on chromosome 19 was more fully mapped and found by similarity to the other tissue kallikreins. Kallikrein 9 has been found in the ovary, thymus, testis, prostate, skin, breast and neuronal tissues and is made by many cell lines in culture. Kallikrein 9 levels in breast cancer and uterine cancer patients have been reported to drop as the disease progresses, thus hK9 might be considered a favorable prognostic marker. Different splice variants of hK9 have been reported, although it is not yet known if they produce functional proteins. The full length Kallikrein 9 encodes for a 250 amino acid protein, with a predicted mass of 27.5 kDa and a pI of 7.53. The 234 amino acid form predicts a protein of 26 kDa with a pI of 9.76 and this quite basic pI might give the shorter form a very different function or localization. The shorter sequence also diverges before the catalytic serine residue, making it unlikely to be proteolytically active. Pre-pro-kallikrein 9 has the 17 amino acid signal sequence is removed before secretion, and the Pro-kallikrein 9 is activated to Kallikrein 9 by removal of the 5 amino acid propeptide domain.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042448-1G , MDL Number: MFCD02259475
Supplier:  Sino Biological
Description:   A DNA sequence encoding the mouse SFN (NP_061224.2) (Met 1-Ser 248) was expressed and purified, with additional two amino acids (Gly and Pro) at the N-terminu.
Supplier:  Promega Corporation
Description:   Recombinant human KDR (amino acids 789-end) was expressed by baculovirus in Sf9 insect cells using an N-terminal GST tag. KDR (or kinase insert domain receptor) is a growth factor receptor tyrosine kinase originally isolated from human endothelial cells.
Supplier:  Bachem Americas
Description:   Sequence: H-Gly-Gln-OH
Supplier:  Bachem Americas
Description:   Sieber amide resin has been developed for the Fmoc-SPPS of fully t-butyl protected peptide amides. Cleavage can be achieved with 1% TFA in methylene chloride. Scavengers may be required. As N-methylation increases the acid-lability of the peptide bond, Malakoutikhah et al. employed Sieber resin for obtaining short peptide amides containing multiple MePhe residues.
Supplier:  AMBEED, INC
Description:   H-β-HoPhe-OH 97%
New Product
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,233 - 7,248  of 162,286