2-Amino-5-cyanobenzoic+acid
Supplier:
Matrix Scientific
Description:
MF=C21H40N2O4 MW=384.56 CAS=27494-47-9 MDL=MFCD00235886 5G
Catalog Number:
(10358-060)
Supplier:
Bioss
Description:
Insulin is a pancreatic hormone that regulates glucose and is involved in the synthesis of protein and fat. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds.Belongs to the insulin family. The insulin-link growth factors, IGF-I and IGF-II (also desinated somatomedin C and multiplication stimulating activator, respectvely), share approximatly 76% sequence identity and are 50% related to pro-insulin.IGF-I and IGF-II are nonglycosylated, single chain proteins of 70 and 76 amino acids in length, respectivelly. IGF-I functions as an autocrine regulator of growth in vaious, whereas the function of IGF-II is less well defined.
Catalog Number:
(10358-054)
Supplier:
Bioss
Description:
Insulin is a pancreatic hormone that regulates glucose and is involved in the synthesis of protein and fat. It increases cell permeability to monosaccharides, amino acids and fatty acids. It accelerates glycolysis, the pentose phosphate cycle, and glycogen synthesis in liver. Heterodimer of a B chain and an A chain linked by two disulfide bonds.Belongs to the insulin family. The insulin-link growth factors, IGF-I and IGF-II (also desinated somatomedin C and multiplication stimulating activator, respectvely), share approximatly 76% sequence identity and are 50% related to pro-insulin.IGF-I and IGF-II are nonglycosylated, single chain proteins of 70 and 76 amino acids in length, respectivelly. IGF-I functions as an autocrine regulator of growth in vaious, whereas the function of IGF-II is less well defined.
Catalog Number:
(10409-222)
Supplier:
Bioss
Description:
BAG proteins compete with Hip for binding to the Hsc70/Hsp70 ATPase domain and promote substrate release. All the BAG proteins have an approximately 45-amino acid BAG domain near the C terminus but differ markedly in their N-terminal regions. The predicted BAG2 protein contains 211 amino acids. The BAG domains of BAG1, BAG2, and BAG3 interact specifically with the Hsc70 ATPase domain in vitro and in mammalian cells. All 3 proteins bind with high affinity to the ATPase domain of Hsc70 and inhibit its chaperone activity in a Hip-repressible manner. [provided by RefSeq].
Catalog Number:
(10112-090)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: SH2D1A antibody was raised against a 10 amino acid synthetic peptide near the internal region of SH2D1A, Application: ELISA, WB
Catalog Number:
(10112-306)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Rat, Immunogen: Zcchc11 Antibody was raised against a 15 amino acid sequence near the internal region of Zcchc11 (mouse), Application: ELISA, WB
Catalog Number:
(10112-904)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: TCFL5 antibody was raised against a 14 amino acid synthetic peptide near the internal region of TCFL5, Application: ELISA, WB
Catalog Number:
(10112-478)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Mouse, Rat, Immunogen: Atoh7 antibody was raised against a 12 amino acid synthetic peptide near the internal region of Atoh7, Application: ELISA
Catalog Number:
(10115-018)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat; Target Species: Mouse; Immunogen: Vipr1 antibody was raised against a 14 amino acid synthetic peptide near the internal region of Vipr1; Applications: ELISA
Catalog Number:
(10116-004)
Supplier:
Prosci
Description:
Polyclonal antibody GOLPH2 Host: Goat Target Species: human immunogen: GOLPH2 antibody was raised against a 13 amino acid synthetic peptide near the C-Terminus of GOLPH2 Application: ELISA
Catalog Number:
(10112-400)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Immunogen: Aminopeptidase A antibody was raised against a 14 amino acid synthetic peptide near the internal region of Aminopeptidase A, Application: ELISA, WB, IHC
Catalog Number:
(10112-014)
Supplier:
Prosci
Description:
Polyclonal, Host: Goat, Species: Human, Porcine, Immunogen: NANOG antibody was raised against a 14 amino acid synthetic peptide near the internal region of NANOG, Application: ELISA, WB, IF
Catalog Number:
(10072-876)
Supplier:
Prosci
Description:
CT-1 is a member of the IL-6 family of cytokines which also includes LIF, CNTF, OSM (Oncostatin M), IL-11, IL-6 and possibly NT-1/ BSF-3. CT-1 is a pleiotropic cytokine which is expressed in various tissues including the adult heart, skeletal muscle, ovary, colon, prostate and fetal lung and signals through the LIF receptor and the gp130 receptor subunit. CT-1 has the ability to induce cardiac myocyte hypertrophy, and enhances the survival of cardiomyocyte and different neuronal populations. Biologically active human CT-1 is synthesized as a 201 amino acid polypeptide lacking a hydrophobic N-terminal secretion signal sequence. Recombinant Human CT-1 is a 21.5 kDa protein consisting of 201 amino acid residues.
Catalog Number:
(AAAL15334-MC)
Supplier:
Thermo Scientific Chemicals
Description:
2-Amino-3-fluoro-4-methylbutyric acid H-3-F-DL-Val-OH. Grade: 94. Melting Point Cca 250*(dec). Boiling Point C: NA. C5H10FNO2. 43163-94-6. IRRITANT
Supplier:
TCI America
Description:
CAS Number: 71989-26-9
MDL Number: MFCD00037138 Molecular Formula: C26H32N2O6 Molecular Weight: 468.55 Purity/Analysis Method: >98.0% (HPLC,T) Form: Crystal Melting point (°C): 124 Specific rotation [a]20/D: -12 deg (C=1, DMF) Storage Temperature: 0-10°C
Supplier:
Anaspec Inc
Description:
This hypophysiotropic peptide was isolated from human hypothalamic-hypophysial tissues. Within this 1 to 29 amino acid GRF fragment, amino acids 13 to 21 are more important than 24 to 29 for high affinity receptor binding. Structure–activity studies show that hpGRF(1–29)-NH2 has full intrinsic activity and potency in vitro as the full length GRF in stimulating growth hormone release. Human GRF (1-29) has a high degree (>93%) homology with procine, bovine and ovine GRF (1-29)-NH2.
Sequence: YADAIFTNSYRKVLGQLSARKLLQDIMSR-NH2 MW: 3357.9 Da % Peak area by HPLC: 95 Storage condition: -20° C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||