Text Search >
2-(Acetylamino)-3-[(4-chlorophenyl)sulfanyl]propanoic+acid
Print…
You Searched For:
33,994 results were found
2-(Acetylamino)-3-[(4-chlorophenyl)sulfanyl]propanoic+acid
Catalog Number:
(76077-694)
Supplier:
Bioss
Description:
Tubulin is the major constituent of microtubules. It binds two moles of GTP, one at an exchangeable site on the beta chain and one at a non-exchangeable site on the alpha chain. TUBB3 plays a critical role in proper axon guidance and mantainance.
Catalog Number:
(76737-320)
Supplier:
ANTIBODIES.COM LLC
Description:
Bovine Interferon alpha/beta Receptor 1 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of bovine Interferon alpha/beta Receptor 1 in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number:
(75791-614)
Supplier:
Prosci
Description:
Mouse Interleukin 36 beta (IL-36B)is a member of the IL-1 family of proteins. It is a cytokine that binds to and signals through the IL1RL2/IL-36R receptor which in turn activates NF-kappa-B and MAPK signaling pathways in target cells linked to a pro-inflammatory response. IL-36B is synthesized in several cells including resting and activated monocytes, and B cells. The receptor for IL-36 beta is thought to be a combination of IL-1 Rrp2 and IL-1 RAcP. Interleukin 36 beta is one part of the IL-36 signaling system that is thought to be present in epithelial barriers and to take part in local inflammatory response; similar to the IL-1 system with which it shares the coreceptor IL1RAP. Interleukin 36 beta are involved in a number of fundamental biological processes such as stimulating production of interleukin-6 and interleukin-8 in synovial fibrobasts, articular chondrocytes and mature adipocytes, inducing expression of a number of antimicrobial peptides including beta-defensin 4 and beta-defensin 103 as well as a number of matrix metalloproteases , inducing the production of proinflammatory cytokines in bone marrow-derived dendritic cells (BMDCs), including IL-12, Il-1 beta, IL-6, TNF-alpha and IL-23, and activating p38 MAPK phosphorylation in BMDCs.Moreover, interleukin 36 beta may be involved in skin inflammatory response by acting on keratinocytes, dendritic cells, and indirectly on T cells to drive tissue infiltration, cell maturation and cell proliferation. It plays an important role in dendritic cell maturation by stimulating the surface expression of CD80, CD86 and MHC class II and inducing the production of IFN-gamma, IL-4 and IL-17 by T helper 1 (Th1) cells, cultured CD4+ T cells and splenocytes.
Catalog Number:
(103404-658)
Supplier:
Novus Biologicals
Description:
The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [Allophycocyanin] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate (negative). The beta 2-Microglobulin Antibody (246-E9.E7 (same as HLA.ABC.m2)) [Allophycocyanin] has been validated for the following applications: Flow Cytometry.
Catalog Number:
(10244-944)
Supplier:
Bioss
Description:
Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is involved in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM1. Integrin alpha-E/beta-7 is a receptor for E-cadherin.
Catalog Number:
(103357-236)
Supplier:
Novus Biologicals
Description:
The Integrin alpha V beta 3 Antibody (23C6) [DyLight 755] from Novus Biologicals is a mouse monoclonal antibody to Integrin alpha V beta 3. This antibody reacts with human. The Integrin alpha V beta 3 Antibody (23C6) [DyLight 755] has been validated for the following applications: Flow Cytometry, Immunohistochemistry, Immunohistochemistry-Frozen.
Supplier:
Anaspec Inc
Description:
This peptide corresponds to the CtoN inverted sequence of Beta-amyloid 1-42.
Sequence: AIVVGGVMLGIIAGKNSGVDEAFFVLKQHHVEYGSDHRFEAD Molecular Weight: 4514.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(220023-325)
Supplier:
R&D Systems
Description:
The Recombinant Human IL-1 beta/IL-1F2 Protein from R&D Systems is derived from E. coli. The Recombinant Human IL-1 beta/IL-1F2 Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(10230-664)
Supplier:
Bioss
Description:
Putative function in synaptic vesicle exocytosis by binding to Munc18-1, an essential component of the synaptic vesicle exocytotic machinery. May modulate processing of the beta-amyloid precursor protein (APP) and hence formation of beta-APP.
Catalog Number:
(102165-086)
Supplier:
Novus Biologicals
Description:
The Common beta Chain Antibody from Novus Biologicals is a rabbit polyclonal antibody to Common beta Chain. This antibody reacts with human. The Common beta Chain Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(77210-462)
Supplier:
ANTIBODIES.COM LLC
Description:
Mouse Retinoic acid Receptor beta ELISA kit is a 90 minutes sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of mouse Retinoic acid Receptor beta in serum, plasma, and other biological fluids.
Catalog Number:
(76733-778)
Supplier:
ANTIBODIES.COM LLC
Description:
Bovine Phospholipase C beta 1/PLCB1 ELISA kit is a sandwich Enzyme-Linked Immunosorbent Assay (sELISA) designed for the <i>in vitro</i> quantitative determination of bovine Phospholipase C beta 1/PLCB1 in serum, plasma, tissue homogenates, and other biological fluids.
Catalog Number:
(76078-800)
Supplier:
Bioss
Description:
Microtubule-associated proteins (MAPs) regulate microtubule stability and play critical roles in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. MAP-light chain 3 beta (MAP-LC3 Beta) and MAP-light chain 3 alpha (MAP-LC3 alpha) are subunits of both MAP1A and MAP1B. MAP-LC3M Beta, a homolog of Apg8p, is essential for autophagy and associated to the autophagosome membranes after processing. Two forms of LC3 Beta, the cytosolic LC3-I and the membrane-bound LC3-II, are produced post-translationally. LC3-I is formed by the removal of the C-terminal 22 amino acids from newly synthesized LC3, followed by the conversion of a fraction of LC3-I into LC3-II. LC3 enhances fibronectin mRNA translation in ductus arteriosus cells through association with 60S ribosomes and binding to an AU-rich element in the 3? untranslated region of fibronectin mRNA. This facilitates sorting of fibronectin mRNA onto rough endoplasmic reticulum and translation. MAP LC3 Beta may also be involved in formation of autophagosomal vacuoles. It is expressed primarily in heart, testis, brain and skeletal muscle.
Catalog Number:
(77524-006)
Supplier:
AFG BIOSCIENCE LLC
Description:
Human bMSH (Beta-Melanocyte Stimulating Hormone) ELISA Kit
Catalog Number:
(10362-510)
Supplier:
Bioss
Description:
IKK Alpha/IKK beta is a member of the IKK complex which is composed of IKK alpha, IKK beta, IKK gamma and IKAP. Phosphorylation of I-Kappa-B on a serine residue by the IKK complex frees NF-kB from I-Kappa-B and marks it for degradation via ubiquination. IKK beta has been shown to activate NF-kB and phosphorylate IKB alpha and beta. Phosphorylation of 2 sites at the activation loop of IKK beta is essential for activation of IKK by TNF and IL1. Once activated, IKK beta autophosphorylates which in turn decreases IKK activity and prevents prolonged activation of the inflammatory response. Additionally, IKK beta activity can also be regulated by MEKK1.
Catalog Number:
(77522-794)
Supplier:
AFG BIOSCIENCE LLC
Description:
Rat TPM2 (Tropomyosin 2 Beta) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
