Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Dimethylaminophenylacetonitrile+hydrochloride


93,878  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"93878"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  AMBEED, INC
Description:   2,4-Dichloro-6-methoxyaniline 95%
Catalog Number: (TS46318-0010)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   Lacidipine
Supplier:  TCI America
Description:   CAS Number: 3965-55-7
MDL Number: MFCD00007493
Molecular Formula: C10H10O7S
Molecular Weight: 296.22
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
Color: White
Flash Point (°C): 200
MSDS SDS
Supplier:  MATTEK CORP MS
Description:   These glass bottom dishes are designed with the combined technology of the convenient standard size 35 and 50 mm disposable plastic petri dishes with the optical quality of glass to provide superior microscopic images.

Supplier:  Restek
Description:   The MTS-32 TD Multiple Tube Sequential Sampler allows sequential sampling of up to 32 thermal desorption tubes (3.5" each).
Supplier:  Thermo Scientific Chemicals
Description:   (alpha,alpha,alpha-Trifluoro-m-tolyl)acetic acid. Grade:98+, Melting Point C77-78*. Boiling Point C:NA. C9H7F3O2. 351-35-9. IRRITANT
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 118-82-1
MDL Number: MFCD00008822
Molecular Formula: C29H44O2
Molecular Weight: 424.67
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 155
MSDS SDS
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 022620-500MG , MDL Number: MFCD08686954
Supplier:  Honeywell Research Chemicals
Description:   Boric Acid, Purity: 99.5-100.5%, Grade: Puriss, Cas number: 10043-35-3, Molecular Formula: H3BO3, Molar mass: 61.83 g/mol, Quality: Meets analytical specification of BP, NF, Ph. Eur, Synonym: Pharma Reagent, Container: Poly bottle, Appearance: Powder, Size: 1KG
MSDS SDS
Catalog Number: (TCC0295-25G)

Supplier:  TCI America
Description:   CAS Number: 95-49-8
MDL Number: MFCD00000562
Molecular Formula: C7H7Cl
Molecular Weight: 126.58
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 159
Melting point (°C): -35
Flash Point (°C): 52
Specific Gravity (20/20): 1.08
MSDS SDS
Supplier:  STILLA TECHNOLOGIES, INC.
Description:   Assay-specific Crystal Flex Probes and primers for the detection of HPV genotypes and its Positive Control. HPV (ALB, HPV16/18/31/33/35/39/45/51/52/56/58) Crystal Digital PCR® Assay is a 10X assay designed to detect and quantify 11 high risk HPV genotypes for cervical cancer plus a reference gene for human DNA quantification using the Ruby Chip.
New Product
Supplier:  Anaspec Inc
Description:   All the HCl salt forms of Aß (1-40), Aß (25-35) and D-Ser26 Aß (25-35), take the ß-structure within a few hours in PBS. They form fibrils, exert toxic effects on hippocampal cultured neurons and suppress MTT reduction activity of non-neuronal (HeLa) cells without cytotoxicity.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVV ? HCl
Molecular Weight: 4329.9+36.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 044883-500MG , MDL Number: MFCD00454124
Supplier:  VWR International
Description:   Featuring a V-neck and chest pocket, this scrub top provides superior protection without sacrificing comfort.
Supplier:  HETTICH INSTRUMENTS
Description:   Angle Rotor, 6 place, Maximum Tube capacity: 50ml, Angle: 35 deg, Maximum RCF: 4,025, Run up: 14 sec, Run down: 17 sec, Temperature: -20 deg C, For Mikro 220 / 220R Microlitre centrifuges
Product available on GSA Advantage®
Supplier:  Genetex
Description:   Hamster Monoclonal antibody to BCL-3
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
7,649 - 7,664  of 93,878