Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-3,6-dimethoxybenzoic+acid


176,025  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"176025"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 035994-500MG , MDL Number: MFCD02255632
Supplier:  Thermo Scientific Chemicals
Description:   MDL: MFCD00000191
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Solid
MSDS SDS

Supplier:  Adipogen
Description:   IL-36alpha (IL-1F6), IL-36beta (IL-1F8) and IL-36gamma (IL-1F9) bind to IL-36R (IL-1Rrp2) and IL-1RAcP, activating similar intracellular signals as IL-1. IL-36Ra inhibits the production of proinflammatory cytokines, including IL-12, IL-1beta, IL-6, TNF-alpha and IL-23 induced by IL-36 in BMDC and CD4 T cells. Skin and dendritic cells are targets of the IL-36 interleukins leading to a Th1 response. These cytokines may represent potential targets for immune-mediated inflammatory conditions or, alternatively, could be used as adjuvants in vaccination.
Catalog Number: (103003-044)

Supplier:  Anaspec Inc
Description:   Beta-amyloid is the main component of amyloid deposits in the AD brain. Beta-amyloid peptides have a heterogeneous C-terminus with the majority composed ofAβ1-40, while a minor product is Aβ 1-42.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMV
Molecular Weight: 4017.5 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   1-Oxa-3,9-diazaspiro[5.5]undecan-2-one hydrochloride 95%
Supplier:  Matrix Scientific
Description:   5-(2-Aminoethyl)-1H-1,2,4-triazol-3-amine dihydrochloride
Supplier:  Matrix Scientific
Description:   (5-Mercapto-4-methyl-4H-1,2,4-triazol-3-yl)methanol

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 038344-500MG , MDL Number: MFCD03030374
Supplier:  ALADDIN SCIENTIFIC
Description:   (Acetylmethylene)triphenylphosphorane ≥98%
New Product
Supplier:  AMBEED, INC
Description:   N-Cyclopropyl-2-(4-(4,4,5,5-tetramethyl-1,3,2-dioxaborolan-2-yl)phenyl)acetamide 96%
Catalog Number: (100263-480)

Supplier:  Indofine Chemical Company
Description:   Flavone 482-36-0 10mg Hyperin, Quercetin-3-galactoside 464.38 220-222[degree]C Hydroscopic 0.98.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  AMBEED, INC
Description:   tert-Butyl 4-((4-(methoxycarbonyl)piperidin-1-yl)methyl)piperidine-1-carboxylate 95%
Supplier:  Thermo Scientific Chemicals
Description:   Nepsilon-Benzyloxycarbonyl-Nalpha-Boc-L-lysine N-succinimidyl ester, Purity: 95%, Cas number: 34404-36-9, Molecular formula: C23H31N3O8, Color: White, Form: Powder, Synonym: Boc-Lys(Z)-Osu, 25G
MSDS SDS

Supplier:  Heathrow Scientific
Description:   A Low-cost way to organize tubes.

Supplier:  Abnova
Description:   Rabbit polyclonal antibody raised against synthetic peptide of histone H3 (trimethylated lysine 36).
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,353 - 6,368  of 176,025