Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

2-Bromo-3,6-dimethoxybenzoic+acid


176,258  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"176258"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   98+%
MSDS SDS
Supplier:  New England Biolabs (NEB)
Description:   An E.coli strain that carries the BsmI gene from Bacillus stearothermophilus NUB 36 (N. Welker).
Small Business Enterprise
Catalog Number: (76480-516)

Supplier:  AAT BIOQUEST INC
Description:   Sulforhodamine B, also known as Kiton Red, is primarily used as a polar tracer.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (101229-584)

Supplier:  New England Biolabs (NEB)
Description:   An E.coli strain that carries the cloned BsmI gene from Bacillus stearothermophilus NUB 36 (N. Welker).
Small Business Enterprise
Supplier:  TCI America
Description:   [Spectrophotometric reagent for alkaline earth metals and indicator for the precipitation titration of SO4 with Ba]
CAS Number: 68504-35-8
MDL Number: MFCD00003942
Molecular Formula: C22H16N4O14S4
Molecular Weight: 776.55
Purity/Analysis Method: >90.0% (HPLC)
Form: Crystal
MSDS SDS
Supplier:  Air Control
Description:   Corrosion-resistant casework cabinets are constructed of stress-relieved, acid-resistant, 1.3 cm (<sup>1</sup>/<sub>2</sub>") thick polypropylene
Supplier:  Matrix Scientific
Description:   MF=C11H10Fno2 MW=207.21 Cas=348-36-7 5G
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041416-5G , MDL Number: MFCD01320862
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 047913-1G , MDL Number: MFCD09027178
Supplier:  Thermo Scientific Chemicals
Description:   98+%
MSDS SDS
Catalog Number: (470149-168)

Supplier:  Shiv Dial Sud & Sons
Description:   CAS Number: 65997-19-5
Formula: Fe
Density: 7.86 g/mL
Freezing Point: 1535 °C
Solubility: Sulfuric Acid and Hydrochloric Acid
Synonyms: Iron Aggregate
Shelf Life: 36 Months
Supplier:  Bioss
Description:   Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY >NPY >PYY (3-36) >NPY (2-36) >[Ile-31, Gln-34] PP >[Leu-31, Pro-34] NPY >PP, [Pro-34] PYY and NPY free acid.

Supplier:  Bioss
Description:   Receptor for neuropeptide Y and peptide YY. The rank order of affinity of this receptor for pancreatic polypeptides is PYY >NPY >PYY (3-36) >NPY (2-36) >[Ile-31, Gln-34] PP >[Leu-31, Pro-34] NPY >PP, [Pro-34] PYY and NPY free acid.

Supplier:  Anaspec Inc
Description:   A 36-amino acid Cl- channel blocker from Leiurus quinquestriatus scorpion venom.
Sequence:MCMPCFTTDHQMARKCDDCCGGKGRGKCYGPQCLCR-NH2 (Disulfide bridge: 2-19,5-28,16-33,20-35)
MW:3996 Da
% peak area by HPLC:95
Storage condition:-20° C
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041462-5G , MDL Number: MFCD04972270
Supplier:  Sino Biological
Description:   A DNA sequence encoding the Influenza A virus (A/Babol/36/2005 (H3N2)) neuraminidase (ACN50232.1) (His 36-Pro 459) was expressed, the cell lysates are collected, and bio-activity was tested. There is an amino acid change from Glutamic to Valine (E119V mutation) in NA / Neuraminidase.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,041 - 1,056  of 176,258
Prev   66  67  68  69  70  71  72  73  74  75  76  77  78  79  80  81  Next