Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

3,4-Dimethoxyaniline


3  results were found

SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"3"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Thermo Scientific Chemicals
Description:   Colorimetric determination of amino acids and amines.
MSDS SDS
Supplier:  Prosci
Description:   IL-7 is a hematopoietic growth factor, which affects primarily early B and T cells. Produced by thymic stromal cells, spleen cells and keratinocytes, IL-7 can also co-stimulate the proliferation of mature T cells in combination with other factors such as ConA and IL-2. Human and murine IL-7 is cross-species reactive. Recombinant human IL-7 is a 17.4 kDa protein containing 153 amino acid residues. Recombinant rat IL-7 is a 15.0 kDa protein containing 130 amino acid residues. Recombinant murine IL-7 is a 15.0 kDa protein containing 130 amino acid residues.
Supplier:  TCI America
Description:   CAS Number: 1074-16-4
MDL Number: MFCD00093566
Molecular Formula: C8H9BrO
Molecular Weight: 201.06
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Boiling point (°C): 132
Flash Point (°C): 113
Specific Gravity (20/20): 1.49
MSDS SDS

Supplier:  Bioss
Description:   The fidelity of protein synthesis requires efficient discrimination of amino acid substrates by aminoacyl-tRNA synthetases. Aminoacyl-tRNA synthetases function to catalyze the aminoacylation of tRNAs by their corresponding amino acids, thus linking amino acids with tRNA-contained nucleotide triplets. ProRS (Prolyl-tRNA synthetase), also known as EPRS, EARS, PARS, QARS, QPRS, PIG32 or GLUPRORS, is a 1,512 amino acid protein that contains three WHEP-TRS domains and belongs to both the class-I and class-II aminoacyl-tRNA synthetase family. Functioning as a component of the multisynthase complex, ProRS uses ATP to catalyze the conversion of L-glutamate and tRNA(Glu) to L-glutamyl-tRNA(Glu), as well as the conversion of L-proline and tRNA(Pro) to L-prolyl-tRNA(Pro).
Catalog Number: (TS25430-0010)

Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   D-(-)-Cysteine 99%
Catalog Number: (101852-944)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041729-1G , MDL Number: MFCD00235885
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-D-Dap(Boc)-OH
Catalog Number: (101094-902)

Supplier:  USP
Description:   (200 mg)
MSDS SDS
Supplier:  PeproTech, Inc.
Description:   LAG-1 is CC chemokine that signals through the CCR5 receptor. LAG-1 is identical to MIP-1β (ACT II isotype) except for two amino acid substitutions; arginine for histidine at position 22 and serine for glycine at position 47 of the mature protein. LAG-1 chemoattracts monocytes, and exhibits activity as an HIV-suppressive factor. Recombinant Human LAG-1 (CCL4L1) is a 7.7 kDa protein containing 69 amino acid residues.
Supplier:  Spectrum Chemicals
Description:   L-Asparagine, Monohydrate, FCC - The FCC grade meets the requirements of the Food Chemical Codex indicates and is suitable for all food, beverage and nutritional supplement applications. Spectrum Chemical offers over 300 Food grade chemical ingredients packaged in laboratory size bottles to production drum quantities and are manufactured, packaged and stored under current Good Manufacturing Practices (cGMP) per 21CFR part 211 in FDA registered and inspected facilities.
Small Business Enterprise
Supplier:  BeanTown Chemical
Description:   CAS: 65710-57-8; MDL No: MFCD08275856 Solid; Molecular Formula: C16H22N2O6; MW: 338.36
MSDS SDS

Supplier:  Prosci
Description:   Serum amyloid A proteins (SAA) represents a family of apolipoproteins that circulates in association with high-density lipoproteins (HDL). The level of apo-SAA, normally 1-5 μg/mL in plasma, increases 500-1000 fold within 24 hours of an inflammatory stimulus and, under these conditions, is the most abundant HDL apo-lipoprotein. The human SAA gene codes for a 122 amino acid nonglycosylated polypeptide, which contains an 18 amino acid N-terminal sequence. Recombinant human apo-SAA1 is an 11.7 kDa protein containing 105 amino acid residues.
Catalog Number: (77669-482)

Supplier:  AMBEED, INC
Description:   AZD-6482 ≥98%
New Product
Supplier:  AMBEED, INC
Description:   (R)-2-((tert-Butoxycarbonyl)amino)-2-(4-hydroxyphenyl)acetic acid, Purity: 98%, CAS Number: 27460-85-1, Appearance: White to Almost white powder to crystal, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 5G
Catalog Number: (103003-050)

Supplier:  Anaspec Inc
Description:   Rat/mouse Amylin differs from the human version in 6 amino acids: H18R, F23L, A25P, I26V, S28P and S29P (first letter is the amino acid of the human sequence). Unlike the human IAPP (Amylin), rat Amylin does not form amyloid fibers.
Sequence: KCNTATCATQRLANFLVRSSNNLGPVLPPTNVGSNTY - NH2 (Disulfide bridge: 2 - 7)
MW: 3920.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C
Catalog Number: (89165-946)

Supplier:  Enzo Life Sciences
Description:   Calcium dye
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
-15 - 0  of 3