Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results

You Searched For:

Ethyl+isothiocyanatoformate


76,570  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"76570"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Chemglass
Description:   Adapter permits vessels to be purged with an inert gas during sampling or transfer with a cannulas.
Small Business Enterprise
Catalog Number: (89074-940)

Supplier:  Ace Glass
Description:   Useful in pouring powders or liquids into ground joint containers
Small Business Enterprise Product available on GSA Advantage®

Supplier:  Bioss
Description:   May regulate apoptosis, cell proliferation and cell differentiation. Binds beta-galactoside and a wide array of complex carbohydrates. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.

Supplier:  Bioss
Description:   May regulate apoptosis, cell proliferation and cell differentiation. Binds beta-galactoside and a wide array of complex carbohydrates. Inhibits CD45 protein phosphatase activity and therefore the dephosphorylation of Lyn kinase. Strong inducer of T-cell apoptosis.
Catalog Number: (77565-652)

Supplier:  Sino Biological
Description:   Y92-30N
New Product
Catalog Number: (103003-158)

Supplier:  Anaspec Inc
Description:   Rat adrenomedullin, rADM, (1-50) and its C-terminal rADM (11-50) induce a dose-dependent and endothelium-independent vasodilation on the arterial mesenteric vasculature.
Sequence:YRQSMNQGSRSTGCRFGTCTMQKLAHQIYQFTDKDKDGMAPRNKISPQGY-NH2 (Disulfide bridge: 14-19)
MW:5729.5 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Catalog Number: (76076-200)

Supplier:  Prosci
Description:   AMY1A Polyclonal Antibody, Host: Rabbit, Species reactivity: Human, Isotype: Ig, Immunogen: KLH conjugated synthetic peptide between 195-223 amino acids from Central region, Synonyms: Alpha-amylase 1,4-alpha-D-glucan gluca
Catalog Number: (103228-972)

Supplier:  Novus Biologicals
Description:   Galectin-2 Antibody, Polyclonal, Host: Sheep, Species: Mouse, Isotype: IgG, Immunogen: E. Coli-derived recombinant mouse Galectin-2 Ser2-Glu130 (Gly36Val), Synonyms: Beta-galactoside-binding lectin L-14-II, galectin 2, Application: WB, IHC, Size: 25UG

Supplier:  Kemtech America
Description:   Use for the transfer of sensitive and hazardous solutions.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Catalog Number: (89059-631)

Supplier:  Ace Glass
Description:   These corrosion-free stainless steel spring wire clamps will securely hold 10/30 - 45/50 glass joints with no screw needed.
Supplier:  MAPA
Description:   Gloves are chemical-resistant and provide thermal insulation.
Supplier:  TCI America
Description:   CAS Number: 5421-92-1
MDL Number: MFCD00012821
Molecular Formula: C10H9ClN2
Molecular Weight: 229.10
Purity/Analysis Method: >98.0% (HPLC,T)
Form: Crystal
MSDS SDS
Supplier:  Ace Glass
Description:   This microscale air condenser is used in reflux experiments
Small Business Enterprise Product available on GSA Advantage®
Catalog Number: (76842-656)

Supplier:  AMBEED, INC
Description:   Isoxazole 98%
Catalog Number: (10115-698)

Supplier:  Prosci
Description:   Polyclonal antibody Cannabinoid Receptor 2 Host: Goat Target Species: human mouse immunogen: Cannabinoid Receptor 2 antibody was raised against a 14 amino acid synthetic peptide near the C-Terminus of Cannabinoid Receptor 2. Application: ELISA, WB
Catalog Number: (10117-354)

Supplier:  Prosci
Description:   Polyclonal; Host: Goat; Species Reactiviy: Mouse; Immunogen: ATG5 antibody was raised against a 14 amino acid synthetic peptide near the internal region of ATG5; Application: ELISA, Western Blot
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,801 - 6,816  of 76,570