Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

L-Asparaginamide+hydrochloride


10,624  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"10624"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 


Supplier:  Azure Biosystems
Description:   Azure Ponceau detects total protein on nitrocellulose and PVDF membranes, allowing you to check the quality of protein transfer before proceeding with Western blotting.
MSDS SDS
Product available on GSA Advantage®
Supplier:  TCI America
Description:   CAS Number: 667-27-6
MDL Number: MFCD00042069
Molecular Formula: C4H5BrF2O2
Molecular Weight: 202.98
Purity/Analysis Method: >98.0% (GC)
Form: Clear Liquid
Flash Point (°C): 21
Specific Gravity (20/20): 1.57
MSDS SDS
Supplier:  BeanTown Chemical
Description:   CAS: 56-40-6; EC No: 200-272-2; MDL No: MFCD00008131; RTECS: MB7600000 Crystalline ; Linear Formula: NH2CH2CO2H; MW: 75.07 Melting Point: 240° (decomposes)
MSDS SDS
Supplier:  Bachem Americas
Description:   For the long-acting GLP-1 analog liraglutide see H-6724.
Supplier:  BeanTown Chemical
Description:   CAS: 4530-20-5; MDL No: MFCD00002690 Powder; Linear Formula: (CH3)3COCONHCH2COOH; Molecular Formula: C7H13NO4; MW: 175.18 Melting Point: 86-89°
MSDS SDS
Supplier:  TCI America
Description:   CAS Number: 13235-36-4
MDL Number: MFCD00150027
Molecular Formula: C10H16N2O8
Molecular Weight: 380.17
Purity/Analysis Method: >98.0% (T)
Form: Crystal
MSDS SDS
Catalog Number: (H-9025.0500BA)

Supplier:  Bachem Americas
Description:   Endothelins are peptides with exceptional vasoconstrictor potency. They play an important role in intercellular communications.
Supplier:  Adipogen
Description:   Potent inhibitor of tumor promoting phorbol ester TPA/PMA (AG-CN2-0010) effects in vivo. Antifungal. Potent and effective inhibitor of formyl peptide receptor (FPR) and formyl peptide-induced superoxide formation. Shows no immunosuppresive activity like other cyclosporins.
Supplier:  Optimize
Description:   OPTI-LOK LP Fittings are an excellent choice for making low-pressure connections into ¹/₄-28 ports. Connections to flat-bottomed ports can be made using OPTI-LOK flat-bottomed ferrules for ¹/₁₆ or ¹/₈" tubing without the need for pre-flanged tubing ends. OPTI-LOK LP Fittings are precision machined to deliver leak-free, zero-dead-volume connections every time. We also offer ¹/₄-28 unions in various through-hole sizes for joining flat-bottom fittings.
Supplier:  Simport Scientific
Description:   Molded from acetal, these patented cassettes keep specimens safely submerged in liquid and are resistant to most histological solvents. The anterior writing area is at a 45° angle to make the cassette more suitable to be used with most types of cassette labeling instruments.
Supplier:  Bachem Americas
Description:   Octreotide is a longer acting synthetic octapeptide analog of the naturally occurring hormone somatostatin. It inhibits the secretion of gastro-entero-pancreatic peptide hormones and the release of growth hormones. Melacini et al. studied the conformation of the peptide in solution by NMR. CAS Number (net): 83150-76-9.
Supplier:  Biotium
Description:   One-Step Lumitein™ Protein Gel Stain is a ready-to-use luminescent red protein gel stain. It is a dramatically improved version of our original Lumitein™ protein gel stain in terms of convenience and safety. One-Step Lumitein™ can detect as little as approximately 1-10 ng of protein per band.
Environmentally Preferable
Supplier:  Bachem Americas
Description:   CRF (corticotropin-releasing factor) is a 41-peptide produced mainly in the hypothalamus. The peptide hormone stimulates ACTH release from the anterior lobe of the pituitary gland. CRF plays an important role in the endocrine, behavioral, and immune response to stress and probably as well in the regulation of energy balance. The human sequence EEPPISLDLTFHLLREVLEMARAEQLAQQAHSNRKLMEII amide also corresponds to the sequence of canine, feline, murine, and porcine CRF.
Supplier:  BeanTown Chemical
Description:   CAS: 1895-39-2; EC No: 217-586-0; MDL No: MFCD00064771 Powder; Linear Formula: ClCF2COONa; MW: 152.46 Melting Point: 196-198° Hygroscopic
MSDS SDS
Supplier:  Pickering Labs
Description:   A prepared Reagent for Automated Post-column Derivatization of Primary and Secondary Amines
Supplier:  BeanTown Chemical
Description:   CAS: 5927-18-4; EC No: 227-663-0; MDL No: MFCD00008452 Liquid; Linear Formula: (CH3O)2P(O)CH2COOCH3; Molecular Formula: C5H11O5P; MW: 182.11 Boiling Point: 265-268°; Flash point: 70°C (158°F) Density (g/mL): 1.125; Refractive Index: 1.437
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,969 - 1,984  of 10,624
Prev