N-(2-Hydroxyethyl)-2-(methylamino)acetamide+hydrochloride
Catalog Number:
(102214-718)
Supplier:
Novus Biologicals
Description:
Rabbit Polyclonal Karyopherin (importin) beta 3 Antibody. Tested Applications: Western Blot. Tested Reactivity: Human.
Supplier:
Anaspec Inc
Description:
This is scrambled control peptide used in studies to compare the effects of Beta-Amyloid (1-42).
Sequence: AIAEGDSHVLKEGAYMEIFDVQGHVFGGKIFRVVDLGSHNVA Molecular Weight: 4514.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(76173-418)
Supplier:
Boster Biological Technology
Description:
Polyclonal antibody for IKB BETA/NFKBIB detection. Host: Rabbit.Size: 100μg/vial. Tested applications: IHC-P. Reactive species: Human. IKB BETA/NFKBIB information: Molecular Weight: 37771 MW; Subcellular Localization: Cytoplasm . Nucleus ; Tissue Specificity: Expressed in all tissues examined.
Catalog Number:
(103323-962)
Supplier:
Novus Biologicals
Description:
The Nicotinic Acetylcholine Receptor beta Antibody (4G4) from Novus Biologicals is a mouse monoclonal antibody to Nicotinic Acetylcholine Receptor beta. This antibody reacts with human. The Nicotinic Acetylcholine Receptor beta Antibody (4G4) has been validated for the following applications: Western Blot, ELISA.
Catalog Number:
(102869-146)
Supplier:
R&D Systems
Description:
The Recombinant Mouse Integrin alpha 10 beta 1 Protein from R&D Systems is derived from CHO. The Recombinant Mouse Integrin alpha 10 beta 1 Protein has been validated for the following applications: Bioactivity.
Catalog Number:
(102252-502)
Supplier:
Novus Biologicals
Description:
The PI4KB / PI4KIII beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PI4KB / PI4KIII beta. This antibody reacts with human. The PI4KB / PI4KIII beta Antibody has been validated for the following applications: Western Blot, Immunoprecipitation.
Catalog Number:
(76464-750)
Supplier:
Boster Biological Technology
Description:
Beta 3 Adrenergic Receptor Polyclonal Antibody, Host: Rabbit, Reactivity: Human, Mouse, Rat, Immunogen: E.coli-derived beta 3 Adrenergic Receptor/ADRB3 recombinant protein, Alternative Names: beta-3 Adrenergic R/ADRB3, ADRB3, ADRB3R, adrenergic, beta-3-, receptor, B3AR, Size: 100ug/vial
Catalog Number:
(10337-618)
Supplier:
Bioss
Description:
The heteromeric transporter OST Alpha/OST Beta facilitates the transport of bile and other steroid solutes across the basolateral epithelial cell membrane of intestine, liver, testis, kidney and adrenal gland. OST Alpha/OST Beta expression is induced by bile acids through ligand-dependent transactivation of their genes by FXR (Farnesoid X-activated receptor). This genetic regulation suggests that in response to changes in intracellular bile acid levels, bile acids adjust the rate of their own efflux from enterocytes. OST Beta is a 128 amino acid single-pass transmembrane protein that requires OST Alpha to localize to the plasma membrane. Coexpression of OST Alpha and OST Beta is also required to convert the OST Alpha subunit to a mature glycosylated endoglycosidase H-resistant form, suggesting that co-expression facilitates trafficking of OST Alpha through the golgi apparatus. Though widely expressed, OST Beta is present at highest levels in ileum.
Catalog Number:
(103269-942)
Supplier:
Novus Biologicals
Description:
The 17 beta-HSD14 / HSD17B14 Antibody from Novus Biologicals is a rabbit polyclonal antibody to 17 beta-HSD14 / HSD17B14. This antibody reacts with human. The 17 beta-HSD14 / HSD17B14 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(220023-640)
Supplier:
R&D Systems
Description:
The Recombinant Human TGF-beta RIII Protein from R&D Systems is derived from NS0. The Recombinant Human TGF-beta RIII Protein has been validated for the following applications: Bioactivity.
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 042295-250MG , MDL Number: MFCD01862863
Catalog Number:
(77526-804)
Supplier:
AFG BIOSCIENCE LLC
Description:
ACTb (Actin Beta) ELISA Kit
Catalog Number:
(103402-948)
Supplier:
Novus Biologicals
Description:
The beta-Galactosidase-1 / GLB1 Antibody (1C9) from Novus Biologicals is a mouse monoclonal antibody to beta-Galactosidase-1 / GLB1. This antibody reacts with human, canine, monkey. The beta-Galactosidase-1 / GLB1 Antibody (1C9) has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(10397-778)
Supplier:
Bioss
Description:
Microtubule-associated proteins (MAPs) regulate microtubule stability and play critical roles in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. MAP-light chain 3 beta (MAP-LC3 Beta) and MAP-light chain 3 alpha (MAP-LC3 alpha) are subunits of both MAP1A and MAP1B. MAP-LC3M Beta, a homolog of Apg8p, is essential for autophagy and associated to the autophagosome membranes after processing. Two forms of LC3 Beta, the cytosolic LC3-I and the membrane-bound LC3-II, are produced post-translationally. LC3-I is formed by the removal of the C-terminal 22 amino acids from newly synthesized LC3∫, followed by the conversion of a fraction of LC3-I into LC3-II. LC3 enhances fibronectin mRNA translation in ductus arteriosus cells through association with 60S ribosomes and binding to an AU-rich element in the 3’ untranslated region of fibronectin mRNA. This facilitates sorting of fibronectin mRNA onto rough endoplasmic reticulum and translation. MAP LC3 Beta may also be involved in formation of autophagosomal vacuoles. It is expressed primarily in heart, testis, brain and skeletal muscle.
Catalog Number:
(10397-776)
Supplier:
Bioss
Description:
Microtubule-associated proteins (MAPs) regulate microtubule stability and play critical roles in neuronal development and in maintaining the balance between neuronal plasticity and rigidity. MAP-light chain 3 beta (MAP-LC3 Beta) and MAP-light chain 3 alpha (MAP-LC3 alpha) are subunits of both MAP1A and MAP1B. MAP-LC3M Beta, a homolog of Apg8p, is essential for autophagy and associated to the autophagosome membranes after processing. Two forms of LC3 Beta, the cytosolic LC3-I and the membrane-bound LC3-II, are produced post-translationally. LC3-I is formed by the removal of the C-terminal 22 amino acids from newly synthesized LC3∫, followed by the conversion of a fraction of LC3-I into LC3-II. LC3 enhances fibronectin mRNA translation in ductus arteriosus cells through association with 60S ribosomes and binding to an AU-rich element in the 3’ untranslated region of fibronectin mRNA. This facilitates sorting of fibronectin mRNA onto rough endoplasmic reticulum and translation. MAP LC3 Beta may also be involved in formation of autophagosomal vacuoles. It is expressed primarily in heart, testis, brain and skeletal muscle.
Catalog Number:
(102253-346)
Supplier:
Novus Biologicals
Description:
The beta-3 Adrenergic R / ADRB3 Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta-3 Adrenergic R / ADRB3. This antibody reacts with human. The beta-3 Adrenergic R / ADRB3 Antibody has been validated for the following applications: Immunohistochemistry-Paraffin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
![]()
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||