Text Search >
2-Phenylethyl+formate
Print…
You Searched For:
16,908 results were found
2-Phenylethyl+formate
Catalog Number:
(10303-520)
Supplier:
Bioss
Description:
Required for efficient formation of myofibers in regenerating muscle at the level of cell fusion. May be involved in growth regulation in hematopoietic cells (By similarity).
Catalog Number:
(MSPP-FAB110A)
Supplier:
R&D Systems
Description:
IgG1 Monoclonal Antibody, Clone: 97924, Host: Mouse, Species reactivity: Human, Isotype: IgG1, Format: Allophycocyanin, Immunogen: Mouse myeloma cell line NS0-derived recombinant human IgG1 Fc region, Application: FC, Storage: 2 to 8 deg C, Size: 100 Tests
Supplier:
R&D Systems
Description:
IL-23 R, monoclonal antibody, Host: Mouse, Clone: 218213, Isotype: IgG2b, Species reactivity: Human, Format: Allophycocyanin, Immunogen: Mouse myeloma cell line NS0-derived recombinant human IL-23 RGly24-Ile354, Application: Flow, Size: 25 tests
Catalog Number:
(103000-892)
Supplier:
Anaspec Inc
Description:
Beta-Amyloid N-terminally truncated (4-42) is highly abundant in Alzheimer disease (AD) brain and was the first Aβ peptide discovered in AD plaques. Aβ 4-42 rapidly forms aggregates possessing a high aggregation propensity in terms of monomer consumption and oligomer formation.
Sequence: FRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIA Molecular Weight: 4198.8 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10802-462)
Supplier:
Rockland Immunochemical
Description:
IGG, Polyclonal Antibody, Conjugate: FITC, Host: Rabbit, Target Species: Donkey, Format: IgG, Specificity: purified from monospecific antiserum, Immunogen: Donkey IgG whole molecule, Isotype: IgG, Application: FLISA, IF, Size: 20MG
Catalog Number:
(10802-306)
Supplier:
Rockland Immunochemical
Description:
CHICKEN IGG F(AB)2, Polyclonal Antibody, Conjugate: FITC, Host: Rabbit, Target Species: Chicken, Format: IgG, Immunogen: Chicken IgG F(ab)2 fragment, Isotype: IgG, Application: FLISA, IF Microscopy, Flow cytometry, Size: 20MG
Catalog Number:
(10800-412)
Supplier:
Rockland Immunochemical
Description:
Bovine IgG F(ab)2 Antibody, Polyclonal, Host: Rabbit, Specificity: IgG F(ab)2, Target Species: Bovine, Format: IgG, Immunogen: Bovine IgG F(ab)2 fragment, Application: ELISA, Western Blot, Immunohistochemistry, Pack Size: 50mg
Supplier:
R&D Systems
Description:
Siglec-7/CD328 Monoclonal Antibody, Clone: 194211, Host: Mouse, Species reactivity: Human, Isotype: IgG1, Format: Phycoerythrin, Immunogen: Mouse myeloma cell line NS0-derived recombinant human Siglec-7, Synonym: p75/AIRM1, Application: Flow Cytometry, Size: 25 Tests
Catalog Number:
(102881-360)
Supplier:
R&D Systems
Description:
Integrin beta 1/CD29, Monoclonal Antibody, Clone: 419217, Host: Mouse, Isotype: IgG1, Species reactivity: Human, Format:Phycoerythrin, Immunogen: Ocular melanoma cell line V+B2, Synonym: Fibronectin receptor subunit beta, VLA-BETA, Application: FC, Size: 100 test
Supplier:
Diagnostic Biosystems
Description:
Transcriptional coactivator that specifically associates with either OCT1 or OCT2. It boosts the OCT1 mediated promoter activity and to a lesser extent, that of OCT2. It has no intrinsic DNAbinding activity. It recognizes the POU domains of OCT1 and OCT2. It is essential for the response of B-cells to antigens and required for the formation of germinal centers.
Catalog Number:
(470165-234)
Supplier:
EMEDCO
Description:
This poster helps employees learn the basics of GHS.
Catalog Number:
(10427-428)
Supplier:
Bioss
Description:
Part of the MIS12 complex, which may be fundamental for kinetochore formation and proper chromosome segregation during mitosis. Four known isoforms exist.
Catalog Number:
(10436-232)
Supplier:
Bioss
Description:
MEI1 is required for normal meiotic chromosome synapsis. It may be involved in the formation of meiotic double-strand breaks (DSBs) in spermatocytes. There are 7 known isoforms.
Catalog Number:
(75930-376)
Supplier:
Rockland Immunochemical
Description:
Neuroligins are Type I membrane proteins enriched in synaptic plasma membranes and clustered in synaptic clefts and postsynaptic densities. They have been characterized as neuronal cell surface proteins and are thought to be involved in cell-cell-interactions by forming intercellular junctions through binding to beta-neurexins. They play a major role in the formation or maintenance of synaptic junctions. They are also thought to be involved in the specification of excitatory synapses. Neuroligins interact with beta-neurexins and this interaction is involved in the formation of functional synapses. Anti-Neuroligin-3 is ideal for research in Neuroscience, including autism research, and Cell Adhesion and Communication.
Supplier:
R&D Systems
Description:
NKG2D/CD314, monoclonal antibody, Host: Mouse, Clone: 149810, Isotype: IgG1, Species reactivity: Human, Format: Alexa Fluor 700, Immunogen: BaF3 mouse pro-B cell line transfected with human NKG2D/CD314, Application: Flow, Size: 25 tests
Catalog Number:
(102513-336)
Supplier:
Adipogen
Description:
The LTbetaR activates two different NF-kappaB pathways that lead to distinct patterns of gene induction, including selected chemokines, and the cytokine BAFF, which is essential for the survival of mature B lymphocytes. LTbetaR activates the classical NF-kappaB (relA/p50) pathway, like the type 1 TNF receptor (TNFR1), that regulates proinflammatory genes, like the chemokine MIP1beta. However, LTbetaR, unlike TNFR1, also activates the processing of p100 to form RelB/p52 complexes, which activate genes involved in lymphoid organ formation and lymphocyte survival.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
