Text Search >
2-Phenylethyl+formate
Print…
You Searched For:
16,908 results were found
2-Phenylethyl+formate
Catalog Number:
(10451-066)
Supplier:
Bioss
Description:
This gene encodes a member of the bone morphogenetic protein family which is part of the transforming growth factor-beta superfamily. The superfamily includes large families of growth and differentiation factors. Bone morphogenetic proteins were originally identified by an ability of demineralized bone extract to induce endochondral osteogenesis in vivo in an extraskeletal site. These proteins are synthesized as prepropeptides, cleaved, and then processed into dimeric proteins. This protein may act as an important signaling molecule within the trabecular meshwork and optic nerve head, and may play a potential role in glaucoma pathogenesis. This gene is differentially regulated during the formation of various tumors. [provided by RefSeq, Jul 2008].
Catalog Number:
(10426-582)
Supplier:
Bioss
Description:
Angiopoietin-like protein 3 (Angptl3) functions as a potent lipoprotein lipase inhibitor and is an important component of plasma triglyceride homeostasis. Angptl3 also plays a role in adipose formation and angiogenesis through its interaction with integrin ?v)beta(3). It is secreted by the liver and is functionally defined by the C-terminal fibrinogen (FBN)-like domain and an N-terminal coiled-coil domain. Angptl3 regulates circulating triglyceride levels during different nutritional states thereby mediating the feeding/fasting cycle. A deficiency of Angptl3 results in abnormally low lipid levels, and a repression of the protein may be protective against atherosclerosis. Angptl3 may also play an important role in hyperlipidemia in diabetes.
Catalog Number:
(75789-576)
Supplier:
Prosci
Description:
Vascular endothelial growth factor D (VEGF-D) is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family. It is highly expressed in lung, heart, small intestine and fetal lung, and at lower levels in skeletal muscle, colon, and pancreas. VEGF-D is growth factor active in angiogenesis, lymphangiogenesis and endothelial cell growth, stimulating their proliferation and migration and also has effects on the permeability of blood vessels. It may function in the formation of the venous and lymphatic vascular systems during embryogenesis, and also in the maintenance of differentiated lymphatic endothelium in adults. It undergoes a complex proteolytic maturation, generating multiple processed forms that bind and activate VEGFR-2 and VEGFR-3 receptors.
Catalog Number:
(75791-696)
Supplier:
Prosci
Description:
Insulin-like growth factors (IGFs) comprise a family of endocrine, paracrine and autocrine polypeptides consisting of the ligands IGF1 and IGF2, two receptors (IGF1R, IGF2R), at least 6 IGF-binding proteins (IGFBPs) and IGFBP proteases. Among the binding proteins, IGFBP6 is unique because of its N-terminal disulfide linkages and its marked binding preference for IGF2. It is a potent inhibitor of the interaction between IGF2 and its receptor IGF1R, thus preventing major functions of IGF2, such as induction of proliferation, differentiation, cell adhesion, or colony formation. In particular, IGFBP-6 inhibited the growth of neuroblastoma and rhabdomyosarcoma xenografts. GFBP-6 is expressed in many tissues, including lung, liver, gut and the central nervous system.
Catalog Number:
(10751-332)
Supplier:
Prosci
Description:
Anosmin Antibody: Mutations in Anosmin-1, an extracellular matrix-associated glycosylated protein, have been linked with Kallmann Syndrome (KS), an X-linked genetic disorder characterized by loss of smell caused by abnormal olfactory bulb development and delayed puberty caused by disrupted migration of the gonadotropin-releasing hormone neuron. Anosmin-1 has been shown to directly bind FGFR1 via its N-terminal cysteine-rich domain, whey-acidic protein-like domain, and its first FnIII repeat with the D2 and D3 ectodomains of FGFR1. It is thought that Anosmin-1 can modulate FGFR1 signaling and have opposing effects on the formation and activation of FGF2-FGFR1-heparing complex.
Catalog Number:
(10339-590)
Supplier:
Bioss
Description:
Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor.
Catalog Number:
(10348-948)
Supplier:
Bioss
Description:
Autophagy receptor that interacts directly with both the cargo to become degraded and an autophagy modifier of the MAP1 LC3 family. Required both for the formation and autophagic degradation of polyubiquitin-containing bodies, called ALIS (aggresome-like induced structures) and links ALIS to the autophagic machinery. Involved in midbody ring degradation. May regulate the activation of NFKB1 by TNF-alpha, nerve growth factor (NGF) and interleukin-1. May play a role in titin/TTN downstream signaling in muscle cells. May regulate signaling cascades through ubiquitination. Adapter that mediates the interaction between TRAF6 and CYLD (By similarity). May be involved in cell differentiation, apoptosis, immune response and regulation of K(+) channels.
Catalog Number:
(10434-382)
Supplier:
Bioss
Description:
Hydrolyzes lysophospholipids to produce lysophosphatidic acid (LPA) in extracellular fluids. Major substrate is lysophosphatidylcholine. Also can act on sphingosylphosphphorylcholine producing sphingosine-1-phosphate, a modulator of cell motility. Can hydrolyze, in vitro, bis-pNPP, to some extent pNP-TMP, and barely ATP. Involved in several motility-related processes such as angiogenesis and neurite outgrowth. Acts as an angiogenic factor by stimulating migration of smooth muscle cells and microtubule formation. Stimulates migration of melanoma cells, probably via a pertussis toxin-sensitive G protein. May have a role in induction of parturition. Possible involvement in cell proliferation and adipose tissue development. Tumor cell motility-stimulating factor.
Catalog Number:
(10666-602)
Supplier:
Bioss
Description:
Cyclin dependent kinase 5 (Cdk5) is a key regulator of cell cycle progression in neuronal differentiation that physically associates with and is activated by the neuron-specific protein p35. CDK5RAP1 (Cdk5 regulatory subunit-associated protein 1), also known as Cdk5 activator-binding protein C42, is a 601 amino acid protein that specifically inhibits Cdk5 activation by p35 through formation of a dimer that inhibits kinase activity. CDK5RAP1 contains one TRAM domain, which is thought to bind tRNA and deliver the RNA-modifying enzymatic domain to its target. There are 4 named isoforms of CDK5RAP1 that are produced as a result of alternative splicing events and are expressed at high levels in heart and skeletal muscle.
Catalog Number:
(10666-622)
Supplier:
Bioss
Description:
Cyclin dependent kinase 5 (Cdk5) is a key regulator of cell cycle progression in neuronal differentiation that physically associates with and is activated by the neuron-specific protein p35. CDK5RAP1 (Cdk5 regulatory subunit-associated protein 1), also known as Cdk5 activator-binding protein C42, is a 601 amino acid protein that specifically inhibits Cdk5 activation by p35 through formation of a dimer that inhibits kinase activity. CDK5RAP1 contains one TRAM domain, which is thought to bind tRNA and deliver the RNA-modifying enzymatic domain to its target. There are 4 named isoforms of CDK5RAP1 that are produced as a result of alternative splicing events and are expressed at high levels in heart and skeletal muscle.
Catalog Number:
(102971-558)
Supplier:
Adipogen
Description:
The LTbetaR activates two different NF-kappaB pathways that lead to distinct patterns of gene induction, including selected chemokines and the cytokine BAFF, which is essential for the survival of mature B lymphocytes. LTbetaR activates the classical NF-kappaB (relA/p50) pathway, like the type 1 TNF receptor (TNFR1), that regulates proinflammatory genes, like the chemokine MIP1beta. However, LTbetaR, unlike TNFR1, also activates the processing of p100 to form RelB/p52 complexes, which activate genes involved in lymphoid organ formation and lymphocyte survival.
Catalog Number:
(103010-162)
Supplier:
Anaspec Inc
Description:
Matrix metalloproteinases (MMPs) belong to a family of secreted or membrane-associated proteins capable of digesting extracellular matrix components
Catalog Number:
(103007-214)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV Molecular Weight: 4328.9 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10836-944)
Supplier:
Hamilton
Description:
Hamilton guard columns protect analytical, semi-prep and preparative HPLC columns.
Catalog Number:
(76196-044)
Supplier:
Prosci
Description:
EDG1 (Endothelial differentiation gene 1), also called Sphingosine-1-phosphate receptor 1 (S1PR1) is the G-protein coupled receptor for Sphingosine 1-phosphate (S1P). Via its interaction with S1P, EDG1 is involved in a number of cellular processes. The binding of S1P leads to angiogenesis and tumor cell motility in cancer, and this interaction also participates in the formation of cell-cell adherens junctions. During embryogenesis, it regulates vascularization. EDG1 interacts with the serotonin receptor 5-HT1AR in the central nervous system. It is also a regulator of innate and adaptive immunity by signaling the release of T-cells from lymph nodes.
Catalog Number:
(10289-608)
Supplier:
Bioss
Description:
Soluble frizzled-related proteins (sFRPS) function as modulators of Wnt signaling through direct interaction with Wnts. They have a role in regulating cell growth and differentiation in specific cell types. SFRP1 decreases intracellular beta-catenin levels (By similarity). Has antiproliferative effects on vascular cells, in vitro and in vivo, and can induce, in vivo, an angiogenic response. In vascular cell cycle, delays the G1 phase and entry into the S phase (By similarity). In kidney development, inhibits tubule formation and bud growth in metanephroi (By similarity). Inhibits WNT1/WNT4-mediated TCF-dependent transcription.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
