Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

22-(tert-Butoxy)-22-oxodocosanoic+acid


152,559  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"152559"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Horse IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Dog IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:  Rockland Immunochemical
Description:   This product has been assayed against 1.0 µg of Cat IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
MSDS SDS
Supplier:  Bioss
Description:   C22orf36 is a 315 amino acid protein that contains two LRR (leucine-rich) repeats and exists as two alternatively spliced isoforms. C22orf36 is encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chromosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Supplier:  Strem Chemicals Inc
Description:   MOF
Supplier:  AAT BIOQUEST INC
Description:   Calcium measurements are critical for numerous biological investigations.
Small Business Enterprise Minority or Woman-Owned Business Enterprise
Supplier:  Bachem Americas
Description:   Sequence: Fmoc-His(1-Me)-OH
Supplier:  Sino Biological
Description:   A DNA sequence encoding human IL22(NP_065386.1) (Ala34-Ile179) was expressed with a N-terminal Met.
Supplier:  Bioss
Description:   C22orf31, also known as HS747E2A or bK747E2.1, is a 290 amino acid protein encoded by a gene located on human chromosome 22, which contains over 500 genes and about 49 million bases. As the second smallest human chromosome, chomosome 22 contains a wide variety of genes with numerous functions. Phelan-McDermid syndrome, Neurofibromatosis type 2 and autism are associated with chromosome 22. A schizophrenia susceptibility locus has been identified on chromosome 22 and studies show that 22q11 deletion symptoms include a high incidence of schizophrenia. Translocations between chromosomes 9 and 22 may lead to the formation of the Philadelphia Chromosome and the subsequent production of the novel fusion protein, BCR-Abl, a potent cell proliferation activator found in several types of leukemia.
Supplier:  BeanTown Chemical
Description:   CAS: 2156-56-1; EC No: 218-461-3; MDL No: MFCD00070489 Solid; Linear Formula: Cl2CHCOONa; MW: 150.93 Melting Point: 198° (decomposes) Moisture Sensitive
MSDS SDS
Catalog Number: (101846-054)

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 038712-500MG , MDL Number: MFCD00041743
Supplier:  BeanTown Chemical
Description:   CAS: 5808-22-0; EC No: 204-972-9; MDL No: MFCD00150612 Powder; Molecular Formula: C10H6Na2O8S2·2H2O; MW: 400.29 Melting Point: <gt/>300°
MSDS SDS
Catalog Number: (103007-214)

Supplier:  Anaspec Inc
Description:   This is amino acids 1 to 40 fragment of the beta-amyloid peptide with lysine substituted for glutamic acid at position 22, found in Italian families. The Italian mutation of beta-amyloid 1-40 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid 1-40. The formation of a salt bridge between Lys-22 and Asp-23 in the minor conformer might be a reason why E22K-beta-amyloid 40 is more pathogenic than wild-type beta-amyloid 40.
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVV
Molecular Weight: 4328.9 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  Biolegend
Description:   Biotin anti-human IL-22 [Poly5161]; Isotype: Goat Polyclonal Ig; Reactivity: Human; Apps: ELISA Detection; Size: 50 μg
Supplier:  TCI America
Description:   CAS Number: 1939-36-2
Molecular Formula: C11H18N2O8
Molecular Weight: 306.27
Purity/Analysis Method: >98.0% (T)
Form: Crystal
Color: White
Melting point (°C): 227
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Difluoromalonic acid diethyl ester. Grade: 97. Melting Point C. Boiling Point C: 94-95*/23mm. C7H10F2O4. 680-65-9. IRRITANT
MSDS SDS
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,761 - 1,776  of 152,559