Text Search >
22-(tert-Butoxy)-22-oxodocosanoic+acid
Print…
You Searched For:
152,559 results were found
22-(tert-Butoxy)-22-oxodocosanoic+acid
Catalog Number:
(101834-970)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 033080-500MG , MDL Number: MFCD03420242
Catalog Number:
(RL709-103-130)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Human IgG in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Supplier:
Justrite
Description:
Steel cabinets store corrosive liquids and acids safely and securely, protecting both personnel and facilities.
Catalog Number:
(101921-254)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 061077-500MG , MDL Number: MFCD02625749
Catalog Number:
(RL610-4604)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Mouse IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(101422-988)
Supplier:
BioVendor
Description:
LDL is a low-density lipoprotein that transports cholesterol and triglycerides from the liver to peripheral tissues. LDL (like all lipoproteins) facilitates the movement of fats and cholesterol within the water based solution of the blood stream. Each natural LDL particle contains a single Apo B-100 molecule (apolipoprotein B-100 is a protein with 4536 amino acid residues) that circulates the fatty acids and keeps them soluble in the aqueous environment. Additionally, the LDL core is highly-hydrophobic, consisting of linoleate (a polyunsaturated fatty acid) and about 1500 esterified cholesterol molecules. This core is enclosed by a shell of phospholipids and unesterified cholesterol in addition to a single copy of B-100 large protein (514 kD). Even though the LDL particles are approximately 22 nm in diameter and have a mass of about 3 million Daltons, they have a mass and size distribution since the LDL particles contain a varying number of fatty acids.
Catalog Number:
(RL200-103-077S)
Supplier:
Rockland Immunochemical
Description:
Anti-Protein A Peroxidase Conjugated has been assayed against 1.0 µg of Protein A (Staphylococcus aureus) in a standard capture ELISA using ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(75789-516)
Supplier:
Prosci
Description:
Ephrins-A3 belongs the Ephrins ligand family which involved in a variety of biological processes, especially in the nervous system and in erythropoiesis. It is shown that Ephrin-A3 is expressed in brain, skeletal muscle, spleen, thymus, prostate, testis, ovary, small intestine, and peripheral blood leukocytes. Ephrin-A3 has a GPI anchor following the extracellular sequence and a signal sequence of 22 amino acids. Ephrin-A3 can bind EphA2, EphA3, EphA4, EphA5, EphA6, EphA7, EphA8 and EphB1. Futhermore, it is associated with tumor growth and metastasis.
Supplier:
MilliporeSigma
Description:
Tauroursodeoxycholic is a detergent useful for the solubilization of lipids and membrane-bound proteins.
Catalog Number:
(10749-454)
Supplier:
Prosci
Description:
PERP Antibody: The p53 tumor-suppressor gene integrates numerous signals that control cell life and death. Several novel molecules involved in p53 network, including Chk2, p53R2, p53AIP1, Noxa, PIDD, PID/MTA2, MTBP and PERP, were identified and their genes were cloned recently. PERP, also termed PIGPC1 and THW, is a plasma membrane protein. p53 binds to the promoter of PERP and transcriptionally activates PERP gene then the translated PERP protein mediates the p53 induced apoptosis. The expression of PERP causes cell death. PERP is a mediator of p53 induced apoptosis. PERP has sequence similarity to PMP-22/gas3 and is a new member of the PMP-22/gas3 family.
Catalog Number:
(RL612-4626)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Rat IgG in a standard capture ELISA using Peroxidase Conjugated Streptavidin and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(RL100-101-189)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Invertase (Candida) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(101831-262)
Supplier:
Matrix Scientific
Description:
Matrix Scientific Part Number: 031146-500MG , MDL Number: MFCD08556202
Catalog Number:
(RL100-101-208)
Supplier:
Rockland Immunochemical
Description:
This product has been assayed against 1.0 µg of Plasminogen (Human Plasma) in a standard ELISA using Peroxidase conjugated Affinity Purified anti-Goat IgG (H&L) (Goat) and ABTS (2,2’-azino-bis-[3-ethylbenthiazoline-6-sulfonic acid])
Catalog Number:
(76871-460)
Supplier:
AMBEED, INC
Description:
4-Amino-1-naphthaleneboronic acid pinacol ester 97%
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
