Text Search >
Print…
Catalog Number:
(103405-048)
Supplier:
Novus Biologicals
Description:
The beta-III Tubulin Antibody (TU-20) [Allophycocyanin] from Novus Biologicals is a mouse monoclonal antibody to beta-III Tubulin. This antibody reacts with human, mouse, all species. The beta-III Tubulin Antibody (TU-20) [Allophycocyanin] has been validated for the following applications: Flow Cytometry.
Catalog Number:
(10231-168)
Supplier:
Bioss
Description:
Involved in embryogenesis and cell differentiation.
Catalog Number:
(77437-042)
Supplier:
Bioss
Description:
The cerebral and vascular plaques associated with Alzheimer's disease are mainly composed of Amyloid beta peptides. beta Amyloid is derived from cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides result from cleavage of Amyloid precursor protein after residues 40, 42, and 43, respectively. The cleavage takes place by gamma-secretase during the last Amyloid precursor protein processing step. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides are major constituents of the plaques and tangles that occur in Alzheimer's disease. beta Amyloid antibodies and peptides have been developed as tools for elucidating the biology of Alzheimer's disease.
Catalog Number:
(102198-958)
Supplier:
Novus Biologicals
Description:
The PILR-beta Antibody from Novus Biologicals is a rabbit polyclonal antibody to PILR-beta. This antibody reacts with human. The PILR-beta Antibody has been validated for the following applications: Western Blot.
Supplier:
Prosci
Description:
Beta-NGF is a neurotrophic factor structurally related to BDNF, NT-3 and NT-4. These proteins belong to the cysteine-knot family of growth factors that assume stable dimeric structures. Beta-NGF is a potent neurotrophic factor that signals through its receptor beta-NGFR, and plays a crucial role in the development and preservation of the sensory and sympathetic nervous systems. Beta-NGF also acts as a growth and differentiation factor for B lymphocytes and enhances B-cell survival. The functional form of human beta-NGF is a noncovalently disulfide-linked homodimer, of two 13.5 kDa polypeptide monomers (238 total amino acid residues). The three disulfide bonds are required for biological activity. The functional form of murine beta-NGF is a noncovalently disulfide-linked homodimer, of two 13.4 kDa polypeptide monomers (240 total amino acid residues). The three disulfide bonds are required for biological activity.
Catalog Number:
(103007-216)
Supplier:
Anaspec Inc
Description:
This is amino acids 1 to 42 fragment of the beta-amyloid peptide, with lysine substituted for glutamic acid at position 22 found in Italian families with Alzheimer's disease. The Italian mutation of beta -amyloid 1 to 42 (E22K) aggregates more rapidly and with more potent neurotoxicity than wild-type beta-amyloid (1-42). The formation of a salt bridge between Lys22 and Asp23 in the minor conformer might be a reason why E22K is more pathogenic than wild-type beta-amyloid (1-42).
Sequence: DAEFRHDSGYEVHHQKLVFFAKDVGSNKGAIIGLMVGGVVIA MW: 4513.1 Da % Peak Area by HPLC: ≥95 Peptide Content: ≥ 60% Storage condition: -20°C
Catalog Number:
(10231-276)
Supplier:
Bioss
Description:
The cerebral and vascular plaques associated with Alzheimer's disease are mainly composed of Amyloid beta peptides. beta Amyloid is derived from cleavage of the Amyloid precursor protein and varies in length from 39 to 43 amino acids. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides result from cleavage of Amyloid precursor protein after residues 40, 42, and 43, respectively. The cleavage takes place by gamma-secretase during the last Amyloid precursor protein processing step. beta Amyloid [1-40], beta Amyloid [1-42], and beta Amyloid [1-43] peptides are major constituents of the plaques and tangles that occur in Alzheimer's disease. beta Amyloid and peptides have been developed as tools for elucidating the biology of Alzheimer's disease.
Catalog Number:
(101215-260)
Supplier:
BioVendor
Description:
RELM-beta (Resistin-Like Molecule-beta) is a member of a recently identified family of secreted proteins containing a conserved cystein-rich C-terminus. The RELM family consists of resistin (also called FIZZ3), RELM-alpha (FIZZ1), RELM-beta (FIZZ2) and RELM-gamma. Only resisistin and RELM-beta were found in humans whereas all four RELM family members were identified in rodents. RELM-beta appears to be produced as a homodimer exclusively by intestinal goblet cells and can be found in high quantities in stool. Remarkably, stool of germ-free mice displaying sterile intestinal tract does not contain RELM-beta until bacterial colonization takes place after pathogen-free mice entered natural environment. Some, but not all, colon carcinoma cell lines secrete RELM-beta into the cell culture supernatant. The physiological function of RELM-beta is not known. High doses of recombinant RELM-beta showed hyperglycemic effects including lowered glucose disposal and increased hepatic glucose production in mice. Total 102 AA. MW: 11 kDa (calculated). UniProtKB acc.no. Q9BQ08. C-Terminal His-tag 12 AA
Catalog Number:
(89335-440)
Supplier:
Genetex
Description:
Rabbit Polyclonal antibody to Dystrobrevin beta (dystrobrevin, beta)
Catalog Number:
(102105-028)
Supplier:
Novus Biologicals
Description:
The Centaurin beta 2 Antibody from Novus Biologicals is a goat polyclonal antibody to Centaurin beta 2. This antibody reacts with human, mouse, rat. The Centaurin beta 2 Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin, Peptide ELISA.
Catalog Number:
(103402-690)
Supplier:
Novus Biologicals
Description:
The beta 2-Microglobulin Antibody (SPM617) [HRP] from Novus Biologicals is a mouse monoclonal antibody to beta 2-Microglobulin. This antibody reacts with human, primate. The beta 2-Microglobulin Antibody (SPM617) [HRP] has been validated for the following applications: Immunohistochemistry-Paraffin.
Catalog Number:
(103270-732)
Supplier:
Novus Biologicals
Description:
The Spectrin beta 1 Antibody from Novus Biologicals is a rabbit polyclonal antibody to Spectrin beta 1. This antibody reacts with human. The Spectrin beta 1 Antibody has been validated for the following applications: Immunohistochemistry, Immunohistochemistry-Paraffin.
Catalog Number:
(103275-876)
Supplier:
Novus Biologicals
Description:
The beta 2-Microglobulin Antibody from Novus Biologicals is a rabbit polyclonal antibody to beta 2-Microglobulin. This antibody reacts with human. The beta 2-Microglobulin Antibody has been validated for the following applications: Western Blot, Immunohistochemistry, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number:
(103359-512)
Supplier:
Novus Biologicals
Description:
The IKK beta Antibody (10A9B6) [Allophycocyanin] from Novus Biologicals is a mouse monoclonal antibody to IKK beta. This antibody reacts with human, mouse. The IKK beta Antibody (10A9B6) [Allophycocyanin] has been validated for the following applications: Flow Cytometry, Flow (Intracellular).
Catalog Number:
(89262-402)
Supplier:
Genetex
Description:
Mouse monoclonal antibody [BB4] to IFN beta
Catalog Number:
(77514-236)
Supplier:
AFG BIOSCIENCE LLC
Description:
Human bEP (Beta-Endorphin) ELISA Kit
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
 is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the
is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
|
|||||||||
List View
