Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

Cyclopropyl(2,6-difluorophenyl)methanone


149,039  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"149039"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Catalog Number: (75791-126)

Supplier:  Prosci
Description:   Interleukin-22(IL-22) is a member of a group of the IL-10 family, a class of potent mediators of cellular inflammatory responses. IL-22 is produced by activated DC and T cells. IL-22 and IL-10 receptor chains play a role in cellular targeting and signal transduction. It can initiate and regulate innate immune responses against bacterial pathogens especially in epithelial cells such as respiratory and gut epithelial cells. IL-22 along with IL-17 likely plays a role in the coordinated response of both adaptive and innate immune systems. IL-22 also promotes hepatocyte survival in the liver and epithelial cells in the lung and gut similar to IL-10. Biological activity of IL-22 is initiated by binding to a cell-surface complex consisting of IL-22R1 and IL-10R2 receptor chains. IL-22 biological activity is further regulated by interactions with a soluble binding protein, IL-22BP. IL-22BP and an extracellular region of IL-22R1 share sequence similarity. In some cases, the pro-inflammatory versus tissue-protective functions of IL-22 are regulated by cytokine IL-17A.
Catalog Number: (103003-156)

Supplier:  Anaspec Inc
Description:   AM (22-52) is known as an adrenomedullin receptor antagonist and a cardiac depressant factor, although there is some discrepancy in the literature regarding the selectivity of ADM 22-52 as adrenomedullin receptor antagonist.
Sequence:TVQKLAHQIYQFTDKDKDNVAPRSKISPQGY-NH2
MW:3576 Da
%Peak area by HPLC:≥95%
Storage condition: -20°C
Supplier:  AMBEED, INC
Description:   (R)-2,2'-Bis[bis(3,5-trifluoromethylphenyl)phosphino]-4,4',6,6'-tetramethoxy)-1,1'-biphenyl, Purity: 98%, CAS Number: 1365531-84-5, Appearance: Solid, Storage: Inert atmosphere, Room Temperature, Size: 250mg
Supplier:  TCI America
Description:   CAS Number: 79-97-0
MDL Number: MFCD00002232
Molecular Formula: C17H20O2
Molecular Weight: 256.35
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 139
Flash Point (°C): 210
MSDS SDS
Supplier:  GOODFELLOW CORPORATION
Description:   Gold ≥99.95%, disk, as roll, Diameter 22 mm
New Product
Supplier:  AMBEED, INC
Description:   (3aS,8aS)-4,4,8,8-Tetrakis(3,5-diethylphenyl)-2,2-dimethyl-6-phenyltetrahydro-[1,3]dioxolo[4,5-e][1,3,2]dioxaphosphepine, Purity: 97%, CAS Number: 2639939-72-1, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  Shenandoah Biotechnology
Description:   Interleukin 22 (IL-22), also called IL-TIF, is an IL-10 family member that is produced by activated dendritic cells and T lymphocytes. IL-22 signals via a heteroduplex receptor consisting of IL-22R and IL-10Rbeta chains. IL-22 is a potent mediator of cellular inflammatory responses. 
Supplier:  Strem Chemicals Inc
Description:   CAS #: 179866-74-1. Size: 1g.
Supplier:  TCI America
Description:   CAS Number: 75714-59-9 MDL Number: MFCD04038415 Molecular Formula: C22H16Br2O2 Molecular Weight: 472.18 Purity/Analysis Method: <gt/>98.0% (GC) Form: Crystal Melting point (°C): 185 Specific rotation [a]20/D: 12 deg (C=1, CHCl3)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (3aS,3a'S,8aR,8a'R)-2,2'-(1,3-Bis(4-(tert-butyl)phenyl)propane-2,2-diyl)bis(3a,8a-dihydro-8H-indeno[1,2-d]oxazole)(97%), Purity: 98% 99%ee, CAS Number: 1435467-28-9, Appearance: White to Yellow Solid, Storage: Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   Bis(2-hydroxyphenyl)methanone, Purity: 99%, CAS Number: 835-11-0, Appearance: Yellow to green to brown Powder or Crystal, Storage: Keep in dark place, Sealed in dry, Room Temperature, Size: 100g
Supplier:  TCI America
Description:   CAS Number: 10038-40-1
MDL Number: MFCD00191613
Molecular Formula: C14H14O3
Molecular Weight: 230.26
Purity/Analysis Method: >98.0% (GC)
Form: Crystal
Melting point (°C): 99
MSDS SDS
Supplier:  AMBEED, INC
Description:   (R)-2-([2,2'-Bipyridin]-6-yl)-4-(tert-butyl)-4,5-dihydrooxazole, Purity: 97% 99%ee, CAS Number: 2757082-47-4, Appearance: Solid, Storage: Keep in dark place, Inert atmosphere, 2-8C, Size: 250MG
Supplier:  AMBEED, INC
Description:   (R)-3,3'-bis(10-phenyl-9-anthracenyl)-1,1'-binaphthyl-2,2'-diyl Hydrogenphosphate, Purity: 98%, CAS Number: 1262129-47-4, Appearance: Solid, Storage: Inert atmosphere, 2-8 C, Size: 25mg
Supplier:  TCI America
Description:   CAS Number: 32233-43-5
MDL Number: MFCD02682967
Molecular Formula: C7H14O3
Molecular Weight: 146.19
Purity/Analysis Method: >95.0% (GC)
Form: Clear Liquid
Boiling point (°C): 92
Flash Point (°C): 101
Specific Gravity (20/20): 1.03
Specific rotation [a]20/D: 2 deg (C=1, CHCl3)
MSDS SDS
Supplier:  AMBEED, INC
Description:   (S)-3,3'-Bis(4-nitrophenyl)-5,5',6,6',7,7',8,8'-octahydro-[1,1'-binaphthalene]-2,2'-diol, Purity: 97%, CAS Number: 2129645-35-6, Appearance: Solid, Storage: Inert atmosphere, 2-8C, Size: 100MG
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,009 - 5,024  of 149,039
  1  2  3  4  5  6  7  8  9  10  11  12  13  14  15  Next