Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

4-Bromo-4\',4\'\'-dimethoxytriphenylamine


13,746  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"13746"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 042335-1G , MDL Number: MFCD01861045
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 049190-500MG , MDL Number: MFCD00021744
Supplier:  Thermo Scientific Chemicals
Description:   3-(4-Thiazolyl)-L-alanine, 95%
MSDS SDS
Supplier:  Spectrum Chemicals
Description:   Guanosine 5'-Triphosphate, Sodium Salt is a purine nucleoside triphosphate which plays a role as an activator of substrates in metabolic reactions.
MSDS SDS
Supplier:  Thermo Scientific Chemicals
Description:   Liquid
MSDS SDS
Supplier:  AMBEED, INC
Description:   (S)-4-(1-(3-(Difluoromethyl)-1-methyl-5-(3-(trifluoromethyl)phenoxy)-1H-pyrazole-4-carboxamido)ethyl)benzoic acid, Purity: 99%, CAS Number: 1369489-71-3, Appearance: Solid, Storage: Sealed in dry, 2-8C, Size: 5MG
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041958-1G , MDL Number: MFCD01863049
Supplier:  MilliporeSigma
Description:   L-3,3'',5-Triiodothyronine, Free Acid, High Purity. (T3). Beige solid. PROTECT FROM LIGHT. Chromatographically purified. Purity: >= 99% by HPLC. Soluble in 100 mM NaOH. RTECS AY6750000, CAS 6893-02-3, M.W. 651.0.
MSDS SDS
Supplier:  LGC STANDARDS
Description:   N-[[4-[2-[[(3-Ethyl-2,5-dihydro-4-methyl-2-oxo-1H-pyrrol-1-yl)carbonyl]amino]ethyl]phenyl]sulfonyl]carbamic Acid Methyl Ester, TRC, LGC Standards
New Product
Catalog Number: (103006-440)

Supplier:  Anaspec Inc
Description:   This peptide is from amino acid 3-42 of the full length 42-amino acid long GIP (Glucose-dependent Insulinotropic Polypeptide or also known as Gastric Inhibitory Polypeptide). The in-vivo degradation of the first two N-terminal amino acids (Tyr-Ala) by the enzyme dipeptidyl peptidase IV (DPP IV) results in making GIP (3-42) a potent antagonist as opposed to the agonist full length GIP on the GIP receptor.
Sequence: EGTFISDYSIAMDKIHQQDFVNWLLAQKGKKNDWKHNITQ
MW: 4759.4 Da
% Peak area by HPLC: 95
Storage condition: -20° C

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 011922-500MG , MDL Number: MFCD01171822
Supplier:  Spectrum Chemicals
Description:   L-Proline, also known simply as proline, is a DNA-encoded amino acids and can be used as a asymmetric catalyst in organic reactions.
MSDS SDS
Supplier:  Bioss
Description:   The protein encoded by ANP32C is one of at least two proteins that are similar in amino acid sequence to PP32 and are part of the same acidic nuclear phosphoprotein gene family. However, unlike PP32, the encoded protein is tumorigenic. The tumor suppressor function of PP32 has been localized to a 25 amino acid region that is divergent between PP32 and the protein encoded by this gene. This gene does not contain introns.
Catalog Number: (103886-226)

Supplier:  Sino Biological
Description:   Methyltransferase / ME-his Recombinant Protein, Purity: > 85 % as determined by SDS-PAGE, Expressed Host: E. Coli, Species: SARS-CoV-2, Molecular Mass: consists of 299 amino acids and predicts a molecular mass of 33.46 kDa, Size: 100 ug
Catalog Number: (10108-900)

Supplier:  Prosci
Description:   As a sodium-dependent amino acid/proton antiporter, SLC38A3 mediates electrogenic cotransport of glutamine and sodium ions in exchange for protons. It also recognizes histidine, asparagine and alanine. It may mediate amino acid transport in either direction under physiological conditions and£íay play a role in nitrogen metabolism and synaptic transmission.
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 041956-5G , MDL Number: MFCD00235906
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
6,033 - 6,048  of 13,746