Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Sale Items
  • Search Within Results

You Searched For:

1-(4-Chloro-2,3-difluorophenyl)ethanol


161,517  results were found

SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"161517"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Spectrum Chemicals
Description:   (Ethylenedinitrilo)tetraacetic Acid, Powder, Reagent, ACS, is generally abbreviated as EDTA, a colorless, water soluble aminopolycarboxylic acid and solid. It is used by many industries and in the laboratory for applications ranging from a sequestering agent to chelation therapy. As an ACS grade Reagent, this Spectrum Chemical manufactured compound is used as the quality standard against which other substances are graded and has met the toughest regulatory standards for quality and pureness
Supplier:  Biotium
Description:   Zinquin is an UV-excitable, blue fluorescent zinc indicator. Zinquin ethyl ester is membrane-permeable and is hydrolyzed into Zinquin free acid once entering cells. Zinc is believed to be involved in the suppression of apoptosis and thought to play important roles in many neural activities.
Supplier:  Bachem Americas
Description:   Sequence: Z-Gly-Gly-OH
Supplier:  Matrix Scientific
Description:   MF=C7H7Cln2O3 MW=202.60 Cas=1194374-11-2 1G
Supplier:  AMBEED, INC
Description:   EDTA tetrasodium salt hydrate ≥98%
New Product
Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 046534-5G , MDL Number: MFCD08443993
Supplier:  Thermo Scientific Chemicals
Description:   It acts as a mild and selective oxidizing agent in organic synthesis and materials science. Manganese(III) Acetate Dihydrate is also a reagent used for radical cyclizations and α-keto-acetoxylation.
MSDS SDS
Supplier:  Spectrum Chemicals
Description:   (1,2-Cyclohexylenedinitrilo)tetraacetic Acid, Reagent is an alkyl-substituted amino acid that functions as a chelating agent. This ingredient's source is synthetic. It appears as a solid and is partially soluble in cold water. Its reagent grade means this is the highest quality commercially available for this chemical and that the American Chemical Society has not officially set any specifications for this material.
Small Business Enterprise
Supplier:  TCI America
Description:   CAS Number: 63-37-6
MDL Number: MFCD00006544
Molecular Formula: C9H14N3O8P
Molecular Weight: 323.20
Purity/Analysis Method: >98.0% (HPLC)
Form: Crystal
Specific rotation [a]20/D: 9.8 deg (C=1, 0.5mol/L Na2HPO4 sol.)
Storage Temperature: 0-10°C
Supplier:  Spectrum Chemicals
Description:   Ethylenediaminetetraacetic Acid Tetrasodium Salt, Solution is typically known as EDTA and is an aminopolycarboxylic acid. It is usually used to dissolve limescale.
MSDS SDS
Small Business Enterprise
Supplier:  Thermo Scientific Chemicals
Description:   1 2-O-Isopropylidene-Alpha-D-Xylofuranose, Purity: 98%, CAS Number: 20031-21-4, Molecular Formula: C8H14O5, Form: Powder, Synonym: 1,2-O-(1-Methylethylidene)-alpha-D-xylofuranose, MAX, Size: 5g
Catalog Number: (103008-246)

Supplier:  Anaspec Inc
Description:   Pramlintide is the first in the new class of amylinomimetic compounds and is a synthetic analogue of the human hormone Amylin, a 37 amino acid peptide. Pramlintide’s peptide sequence differs from Amylin by replacing proline at postitions 25, 28, and 29. Pramlintide has a disulfide bridge between C2 and C7. For Research Use Only.
Sequence: KCNTATCATQRLANFLVHSSNNFGPILPPTNVGSNTY-NH2 (S-S Bond) acetate salt
MW: 3949.5 Da
% Peak Area by HPLC: ≥ 95%
Storage condition: -20°C

Supplier:  MilliporeSigma
Description:   A non-essential amino acid. It can be used in the preparation of biological buffers.

Supplier:  MilliporeSigma
Description:   For molecular biology. DNase-, RNase-, protease-, and phosphatase-free.
MSDS SDS
Supplier:  THERMO FISHER SCIENTIFIC CHEMICALS
Description:   DL-Proline 99%

Supplier:  Matrix Scientific
Description:   Matrix Scientific Part Number: 064884-500MG , MDL Number: MFCD11108910
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
5,025 - 5,040  of 161,517