Keep my session open?
Ending In 
The session is expired
Your session has expired. For your security, we have logged you out.
Would you like to log in again?

Update to Avantor’s response to the coronavirus (COVID-19) pandemic

  • Product Results
  • Product Category
  • Criteria
  • Supplier
  • Refine by Suppliers
    Sort by:

  • Search Within Results


SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-SearchPresentationType-HORIZONTAL
 
 
SearchResultCount:"44150"
  List View Searching Easy View BETA(new)
Sort by:
 
 
 
 

Supplier:  Novus Biologicals
Description:   The Spectrin beta 3 Antibody [DyLight 650] from Novus Biologicals is a rabbit polyclonal antibody to Spectrin beta 3. This antibody reacts with human. The Spectrin beta 3 Antibody [DyLight 650] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Supplier:  AFG BIOSCIENCE LLC
Description:   Monkey Beta-Defensin 123(DEFB123) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Porcine Beta Hydroxybutyric Acid (BHBA) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Beta-Hydroxybutyric Acid(β-OHB) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Human Beta-2 Adrenergic Receptor (ADRB2) ELISA Kit

Supplier:  AFG BIOSCIENCE LLC
Description:   Human beta 3 Adrenergic Receptor (ADRB3) ELISA Kit
Supplier:  ANTIBODIES.COM LLC
Description:   Recombinant rabbit monoclonal [RM453] antibody to GSK3 beta (phospho Ser9) for WB with samples derived from Human.
Catalog Number: (103007-612)

Supplier:  Anaspec Inc
Description:   Beta-amyloid 1-55 is the the 672-726 fragment of APP.
Sequence: DAEFRHDSGYEVHHQKLVFFAEDVGSNKGAIIGLMVGGVVIATVIVITLVMLKKK
Molecular Weight: 5982.1 Da
% Peak Area by HPLC: ≥95
Peptide Content: ≥ 60%
Storage condition: -20°C
Supplier:  CUBE BIOTECH
Description:   Octylglucopyranoside are well suited for the solubilization, stabilization, and purification of membrane proteins. For screening of the best-suited detergent for a given application, we offer glucosides with chain lengths from C-8 to C-10, as well as octylthioglucoside.

Supplier:  R&D Systems
Description:   The Recombinant Human/Feline CXCL12/SDF-1 beta (aa 22-93) from R&D Systems is derived from E. coli. The Recombinant Human/Feline CXCL12/SDF-1 beta (aa 22-93) has been validated for the following applications: Bioactivity.

Supplier:  R&D Systems
Description:   The Recombinant Mouse IL-1 beta/IL-1F2 Protein from R&D Systems is derived from E. coli. The Recombinant Mouse IL-1 beta/IL-1F2 Protein has been validated for the following applications: Bioactivity.
Supplier:  Novus Biologicals
Description:   The beta Tubulin Antibody (BT7R) [PerCP] from Novus Biologicals is a mouse monoclonal antibody to beta Tubulin. This antibody reacts with human, mouse, rat, avian, chicken, primate, rabbit. The beta Tubulin Antibody (BT7R) [PerCP] has been validated for the following applications: Western Blot, Flow Cytometry, ELISA, Immunocytochemistry / Immunofluorescence, Immunohistochemistry-Paraffin.
Catalog Number: (103611-468)

Supplier:  Sino Biological
Description:   Produced in rabbits immunized with purified, recombinant Human PSG1 / PS-beta-G-1 (rh PSG1 / PS-beta-G-1; Catalog#15378-H08H; NP_001171754.1; Met1-Pro419). PSG1 / PS-beta-G-1 specific IgG was purified by Human PSG1 / PS-beta-G-1 affinity chromatography.
Supplier:  Novus Biologicals
Description:   The Spectrin beta 3 Antibody [DyLight 488] from Novus Biologicals is a rabbit polyclonal antibody to Spectrin beta 3. This antibody reacts with human. The Spectrin beta 3 Antibody [DyLight 488] has been validated for the following applications: Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Supplier:  Bioss
Description:   Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is involved in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM1. Integrin alpha-E/beta-7 is a receptor for E-cadherin.

Supplier:  Bioss
Description:   Integrin alpha-4/beta-7 (Peyer patches-specific homing receptor LPAM-1) is involved in adhesive interactions of leukocytes. It is a receptor for fibronectin and recognizes one or more domains within the alternatively spliced CS-1 region of fibronectin. Integrin alpha-4/beta-7 is also a receptor for MADCAM1 and VCAM1. It recognizes the sequence L-D-T in MADCAM1. Integrin alpha-E/beta-7 is a receptor for E-cadherin.
Inquire for Price
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
Stock for this item is limited, but may be available in a warehouse close to you. Please make sure that you are logged in to the site so that available stock can be displayed. If the call is still displayed and you need assistance, please call us at 1-800-932-5000.
This product is marked as restricted and can only be purchased by approved Shipping Accounts. If you need further assistance, email VWR Regulatory Department at Regulatory_Affairs@vwr.com
-Additional Documentation May be needed to purchase this item. A VWR representative will contact you if needed.
This product has been blocked by your organization. Please contact your purchasing department for more information.
The original product is no longer available. The replacement shown is available.
This product is no longer available. Alternatives may be available by searching with the VWR Catalog Number listed above. If you need further assistance, please call VWR Customer Service at 1-800-932-5000.
1,505 - 1,520  of 44,150